KEGG   Yersinia pestis A1122: A1122_15240Help
Entry
A1122_15240       CDS       T01831                                 

Gene name
oppB
Definition
(GenBank) oligopeptide transporter permease
  KO
K15581  oligopeptide transport system permease protein
Organism
ypt  Yersinia pestis A1122
Pathway
ypt01501  beta-Lactam resistance
ypt02010  ABC transporters
ypt02024  Quorum sensing
Module
ypt_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A1122_15240 (oppB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A1122_15240 (oppB)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    A1122_15240 (oppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypt02000]
    A1122_15240 (oppB)
Transporters [BR:ypt02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    A1122_15240 (oppB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEL73672
Position
complement(3302181..3303101)
Genome map
AA seq 306 aa AA seqDB search
MLKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGERNLPPEVMANIEAKYHLNDPIY
KQYFNYLGQLAKGDLGPSFKYKDYTVNDLVSSSFPVSAKLGFAAFMLAVILGVSAGVIAA
LNQNTKWDYTVMGFAMTGVVIPSFVVAPLLVLVFAIILKWLPGGGWNGGAPKYIILPMVA
LSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPLRTIVLRHALKPALLPVLSYMGPAF
VGIITGSMVIETIFGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVI
DPKIRY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtttattctacgtcgttgtctggaagcgattccgacgctatttatcttgatt
accatctcattctttatgatgcgcctcgctcccggaagcccatttactggtgagcgtaac
cttcctccagaagttatggctaatattgaggcgaagtatcacctcaatgatcctatttat
aaacagtatttcaattacttggggcaacttgcaaaaggtgaccttggcccgtcgtttaaa
tataaagattacaccgtgaacgatttagtttcatcgtcgtttcccgtctcagcaaaactg
gggtttgccgcatttatgttagcggtaatattaggtgtcagtgctggagtgatcgcggcg
ctgaaccaaaatacgaagtgggactatacggtgatgggttttgcgatgactggggtcgtc
atacccagttttgtggttgctcctttattagtgctggttttcgccattatattgaaatgg
ctccctggtggtggctggaatggtggtgcaccaaaatatatcattttacctatggttgcg
ctgtcattggcctatatcgccagtattgcgcgtattacccgcgggtcaatgattgaagtt
ctgcactccaattttattcgaactgcacgtgcgaaggggttaccactacgtacaattgta
ttgcgccatgcattaaagccagcgttactaccggttctttcctatatggggccagctttt
gttggcattattacgggatcgatggttattgaaactatttttggcttaccgggtattggc
caattatttgtcaacggggcgttaaaccgcgattactcattggtcttgagtctgactatt
ttggtcggcgctttaactattttatttaatgcgattgttgacgtgttgtatgccgttatc
gatccaaaaatccgttactag

DBGET integrated database retrieval system