KEGG   Yersinia pestis A1122: A1122_15265Help
Entry
A1122_15265       CDS       T01831                                 

Definition
(GenBank) transposase/IS protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IstB_IS21 Bac_DnaA AAA PhoH AAA_22 Lon_2 AAA_14 AAA_16 RsgA_GTPase AAA_5 ZapC Sigma54_activat AAA_25 AAA_24 ABC_tran RuvB_N AAA_28
Motif
Other DBs
NCBI-ProteinID: AEL73677
Position
3311347..3312129
Genome map
AA seq 260 aa AA seqDB search
MMMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEHLLHEEKLARHQRKQ
AMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNENIVLLGPSGVGKTHLA
IAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVMAPRLLIIDEIGYLPFS
QEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTSAMLDRILHHSHVVQIKG
ESYRLRQKRKAGVIAEANPE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgatgatggaactgcaacatcaacgactgatggcgctcgccgggcagttgcaactggaa
agccttataagcgcagcgcctgcgctgtcacaacaggcagtagaccaggaatggagttat
atggacttcctggagcatctgcttcatgaagaaaaactggcacgtcatcaacgtaaacag
gcgatgtatacccgaatggcagccttcccggcggtgaaaacgttcgaagagtatgacttc
acattcgccaccggagcaccgcagaagcaactccagtcgttacgctcactcagcttcata
gaacgtaatgaaaatatcgtattactggggccatcaggtgtggggaaaacccatctggca
atagcgatgggctatgaagcagtccgtgcaggtatcaaagttcgcttcacaacagcagca
gatctgttacttcagttatctacggcacaacgtcagggccgttataaaacgacgcttcag
cgtggagtaatggccccccgcctgctcatcattgatgaaataggctatctgccgttcagt
caggaagaagcaaagctgttcttccaggtcatcgctaaacgttacgaaaagagcgcaatg
atcctgacatccaatctgccgttcgggcagtgggatcaaacgttcgccggtgatgcagca
ctgacctcagcgatgctggaccgtatcttacaccactcacatgtcgttcaaatcaaagga
gaaagctatcgactcagacagaaacgaaaggccggggttatagcagaagctaatcctgag
taa

DBGET integrated database retrieval system