KEGG   Yersinia pestis A1122: A1122_15270Help
Entry
A1122_15270       CDS       T01831                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00240  Pyrimidine metabolism
ypt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A1122_15270
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A1122_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AEL73678
Position
complement(3312498..3313088)
Genome map
AA seq 196 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAQ
LYNSGTSLLSIIAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDEQGRAVHNGEQVVIGGNESYVS
VCRRHYKEAIKAACCS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttacttttattactctgcaatgaacgcggggaaatccacagcacttcta
cagtcctcatataactaccaagaacgaggtatgcgcaccttggtgtttacggctgagata
gataaccgctttggtgtcggaacggtaagttcacgcattggcctctcttctcaggcccag
ctctataatagcgggacatcattgttatctattatcgccgctgagcaccaggacacacct
attcattgtattctattggatgaatgtcaatttctgactaaagagcaggtccaggaactc
tgtcaggttgttgatgaattacatcttcctgttctttgctacggcctgcggactgatttt
ctcggcgaattatttcccggtagtaaatatttactggcgtgggcggacaaattagtggag
ttgaaaaccatttgtcattgcggtcgtaaagcaaacatggttcttcgcctggatgagcag
gggagagcggtacacaatggtgaacaggtcgttattggtggcaatgaaagctatgtttct
gtctgccgccgccattataaagaagcaattaaagccgcctgctgttcgtag

DBGET integrated database retrieval system