KEGG   Yersinia pestis A1122: A1122_15280Help
Entry
A1122_15280       CDS       T01831                                 

Definition
(GenBank) putative nucleotide sugar dehydrogenase
  KO
K00012  UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00040  Pentose and glucuronate interconversions
ypt00053  Ascorbate and aldarate metabolism
ypt00520  Amino sugar and nucleotide sugar metabolism
ypt01100  Metabolic pathways
Module
ypt_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A1122_15280
   00053 Ascorbate and aldarate metabolism
    A1122_15280
   00520 Amino sugar and nucleotide sugar metabolism
    A1122_15280
Enzymes [BR:ypt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     A1122_15280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C NAD_binding_11 3HCDH_N NAD_binding_2 ApbA TrkA_N Ycf54 DUF2795
Motif
Other DBs
NCBI-ProteinID: AEL73680
Position
complement(3314683..3316029)
Genome map
AA seq 448 aa AA seqDB search
MKVTVFGIGYVGLVQATVLAEVGHDVLCIDIDANKVADLKKGRIAIFEPGLAPLVKENYE
AGRLQFSTDAQAGVAHGVIQFIAVGTPPDEDGAADLKYVLDVASTIGTYMDSPKVIIDKS
TVPVGTADKVHQVIQAILEQRGEKIDFSVVSNPEFLKEGAAVADCKRPERIVIGIDTDDS
GALELISELYEPFNRNHDRMLVMDIRSAELTKYAANGMLATKISFMNEIANIAERLGADI
EKVRQGIGSDSRIGYHFIYSGCGYGGSCFPKDIQALIRTAEDKGYKPQLLQAVEQINNQQ
KYKLTEFIKSHFNSQLAGKTFAVWGLAFKPNTDDMREAPSRVVMESLWEAGATIQAYDPE
AMDETQRIYGARDDLRLMGTKESALQGADALIICTEWQSFRAPDFDMIKSRLKHPVIFDG
RNLYDPERLNSRGFTYYGIGRGVSINLS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttacggtttttggtattggttatgtgggacttgttcaagctacagtgcttgcc
gaggtggggcatgatgtcctttgtatcgatattgatgctaataaagttgccgatttgaaa
aaaggccgtattgctatttttgagccgggcttggctccgttggtcaaagaaaactatgag
gcaggcagattacagttttcaacagatgcgcaagctggtgtggcacatggcgtcattcaa
tttattgctgtgggtacacctcctgatgaagacggtgctgccgatcttaaatatgtcctt
gatgtggccagtaccattggcacgtatatggactcacctaaggtcattatcgataaatct
acagtgcccgtggggacagcggataaagtacatcaagttatacaagctattttggagcag
cgcggtgagaagatagattttagtgtggtatcaaatcctgagtttttaaaagagggggcc
gcagttgctgattgtaaacggcctgaacgtattgttattggtattgatacggatgacagt
ggtgctctagagttaatcagtgaattatacgaaccttttaatcgaaatcatgatcgtatg
ctagtaatggatatccgtagtgcagaactgacaaagtatgctgcaaacggcatgctggca
acgaaaataagtttcatgaatgagattgctaatattgctgagcgattaggggctgatatc
gaaaaagttcgacagggcatcggttccgattcacgtattggataccatttcatttattct
ggttgtggttatggggggtcttgtttcccaaaagacatccaagcattaattcgtactgca
gaagataagggttataagccccagctattgcaggctgtcgagcaaatcaataatcagcag
aagtataagttaactgaattcattaaaagtcattttaattcgcagttagctggaaaaaca
tttgctgtctggggattggcctttaagcccaacaccgatgatatgcgtgaggcaccgagc
cgtgtggtaatggaatcattgtgggaagccggggctacaattcaagcatacgatcccgaa
gcaatggatgagacgcaacgcatttatggtgcaagagatgatttgagattaatggggact
aaagagtctgcattacagggagctgatgccttgattatttgtactgaatggcaaagtttt
cgtgctccagattttgatatgatcaagtcaaggttaaagcaccctgttatttttgatggg
cgtaatttgtacgatccagaacgcctaaatagtcgtgggttcacttattatggaattggg
cgtggtgtttcgattaatctatcatag

DBGET integrated database retrieval system