KEGG   Yersinia pestis A1122: A1122_15290Help
Entry
A1122_15290       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K09858  SEC-C motif domain protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SEC-C CW_binding_1
Motif
Other DBs
NCBI-ProteinID: AEL73682
Position
3318785..3319150
Genome map
AA seq 121 aa AA seqDB search
MRSRYCAYVEKNVDYLIATWHPDCHAQEWRESIIQGFTKTVWHGLTVIAETPGRHPDEAF
VEFIARFTDADNAQITAMHERSRFLRIKEHWYYIDGIRPSLGRNDTCLCGSGKKHKKCCG
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgcgctattgtgcttatgtagaaaaaaatgtggattatctgattgctacctgg
catccagactgtcatgcacaggagtggcgagaaagtatcattcaaggctttaccaagacg
gtgtggcatgggctaacagttattgctgagactcccggtcgccatcctgatgaagctttt
gtggagtttattgcccgtttcaccgatgcagataatgcacagataacggcaatgcacgaa
cgttctcgcttcctacgtataaaagaacactggtactatattgacggtatccgcccctct
ttgggtagaaacgatacatgtctttgcggttcggggaaaaaacacaagaaatgctgtggc
cgttaa

DBGET integrated database retrieval system