KEGG   Yersinia pestis A1122: A1122_15300Help
Entry
A1122_15300       CDS       T01831                                 

Definition
(GenBank) transposase for the IS285 insertion element
  KO
K07493  putative transposase
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    A1122_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_mut MULE DUF433
Motif
Other DBs
NCBI-ProteinID: AEL73684
Position
complement(3320066..3321274)
Genome map
AA seq 402 aa AA seqDB search
MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEKNTPKSGSNT
RNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREI
VATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIVYMDCIVVKVRQNGSVIN
KAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRGLQDILIACVDGLKGFPDA
INSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVYQAPTEEAALMALDKFAEAW
DDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIESVNSVIRAAIKKRKVFPTDDS
VRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLSDHL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaagaaacttaaagcacttgcggctgaactggctaaaggtcttaaaaccgaa
gccgaccttaatgcattttctcgtatgctaacaaagcttaccgtcgaaacagcgttaaat
gcagagcttaccgaacacctcgggcacgagaaaaatacccctaaatcaggctcgaatacc
cgcaacggctattcgtccaaaacactgctatgcgacgacggcgaaatcgagctgaatacg
ccacgcgaccgcgaaaacacctttgaaccgcagctgataaagaaaaatcagacgcgtatc
acacagatggacagccagattttgtccctgtacgccaaaggcatgaccacccgcgaaatc
gtcgccaccttcaaagagatgtatgacgccgatgtgtctcccacgctgatatctaaagtc
accgatgccgtaaaagagcaggttgctgaatggcaaaaccgccaactggatgctctgtat
cccattgtttatatggactgcattgtcgtaaaagtccgccagaacggtagcgtgataaac
aaagcagtgttcctagcgctgggcatcaacactgaaggtcagaaagagctgctgggcatg
tggctggcagaaaatgaaggtgcgaagttctggctaagtgtgctgacagagctaaaaaat
cgcggtcttcaggacattctgattgcctgcgtggatggcctgaaggggttcccggatgcg
ataaacagtgtttatccgcagactcacatccagctgtgcatcatccatatggtacgcaac
agcctgaaatatgtgtcatggaaggactataaagccgtcaccagcggtttgaaaatggtg
tatcaggctccgacagaagaggcggcgctgatggcgctggataagtttgcggaggcctgg
gacgacaaatacccgcaaattagcaaaagttggcgtacgcactgggaaaatctcaataca
ttcttcggctatccgcccgatatccgcaaggctatctacaccacgaatgccatcgaatcg
gtgaacagcgtgatccgtgcagccattaaaaagcgcaaagtgttcccgacagacgactca
gtgcggaaggttgtttatttggcgatcaaggatgcatcaaaaaaatggagtatgccgatc
cagaactggcggttagcgatgagccgttttattatcgagttcggtgaccgcctgagcgat
cacctttaa

DBGET integrated database retrieval system