KEGG   Yersinia pestis A1122: A1122_15310Help
Entry
A1122_15310       CDS       T01831                                 

Definition
(GenBank) putative LysR-family transcriptional regulatory protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 DUF3964
Motif
Other DBs
NCBI-ProteinID: AEL73685
Position
complement(3321973..3322833)
Genome map
AA seq 286 aa AA seqDB search
MFLSRKLEAFMAVVENGSLSKAARVMNRTTPPVAKSIKDFESIIGKKLFKREKFGMSLTR
DGEVLYNDLKDLYQQEKEITKKHLTGHVSNVINIYYDWGKSENLTQLYKIAEKNNIQANI
IKFYYENIDEIGDYDGNSLILSSEKIASERFMLLNEVQDIGFGIYGRKDIINESEDIINI
LHSNVWLCNPTLYKSKFVKSLEESVKKQYDKVSVRQVDNLACCLNFIYSGRYICITDSIM
DDFNGDSKLDFVNLTNFKDENKLYFYKSRSHSSVLNRLIDYIHTLE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtttctatctcgaaagttagaagcctttatggcagtagttgagaatggttcgctaagt
aaagccgcaagagtgatgaatagaacaacacctcctgttgcaaaatcgataaaagacttt
gaaagcataatagggaaaaaactctttaaaagagagaaatttggcatgagcctcacacgt
gatggtgaggttctatacaatgatctaaaagatttgtatcaacaagaaaaagaaataact
aaaaagcatctcacgggtcatgtgtcaaatgttattaatatttattacgactggggtaaa
agtgagaatttaactcaactttataaaatcgcagaaaaaaacaatattcaagcaaatata
attaagttttattatgaaaatattgatgaaattggagattatgatgggaattcacttata
ttatcatctgagaaaatagccagtgaaagatttatgcttttgaacgaagtacaagatatt
ggttttggtatatatgggagaaaggatataattaatgaaagtgaagatattataaatatt
cttcacagtaatgtttggttatgtaatccgacattatacaaaagtaaatttgttaagtca
cttgaagaatctgttaaaaaacaatatgataaggttagtgttaggcaggttgataatttg
gcctgttgtttgaattttatctattcaggacgttacatttgtattaccgattcaataatg
gatgattttaatggtgattcaaagttggattttgtaaatttaacgaattttaaagatgaa
aataaattatatttttacaaatcaagatcacactctagcgtattaaatcgtcttattgat
tatatacatacattggagtaa

DBGET integrated database retrieval system