KEGG   Yersinia pestis A1122: A1122_15320Help
Entry
A1122_15320       CDS       T01831                                 

Definition
(GenBank) pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase
  KO
K08320  (d)CTP diphosphatase [EC:3.6.1.65]
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A1122_15320
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.65  (d)CTP diphosphatase
     A1122_15320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2
Motif
Other DBs
NCBI-ProteinID: AEL73687
Position
3324547..3324933
Genome map
AA seq 128 aa AA seqDB search
MIDVVAAIIERDGKILLAQRDGQSDQAGLWEFPGGKVEAGETQPQALIRELAEELGIEAT
VAGYIATNQWVAANNRIRLHAWYVNHFSGEPVRHCHAAFIWLTPLEAYRYSLAPADIPLL
DAFIAQRQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtcgtcgccgccattatagaacgggatgggaagatattactggcccagcgg
gatgggcaaagcgatcaagcagggctgtgggaatttcctggaggcaaagttgaggctgga
gaaactcagcctcaggcgctgatccgtgagcttgccgaagagttaggtatcgaggccact
gtcgctgggtatatcgcaaccaaccaatgggtagcagccaataaccgtatccgcttacat
gcctggtatgttaaccattttagcggagagccagtaaggcattgccatgcggcgtttatc
tggctgacgccgctggaggcgtaccgctactctctggcgcccgcagatattccgctgcta
gacgcgtttatcgcacagagacaataa

DBGET integrated database retrieval system