KEGG   Yersinia pestis A1122: A1122_15335Help
Entry
A1122_15335       CDS       T01831                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00450  Selenocompound metabolism
ypt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    A1122_15335
Enzymes [BR:ypt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     A1122_15335
Transfer RNA biogenesis [BR:ypt03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    A1122_15335
 Prokaryotic Type
    A1122_15335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AEL73690
Position
complement(3327220..3328266)
Genome map
AA seq 348 aa AA seqDB search
MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNG
VGIISTTDFFMPIVDDPFDFGRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQ
VIEGGRYVCQQAGISLAGGHSIDAPEPILGLAVTGIVSTEQVKKNSAAKPGCKLFLTKPL
GIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQKQLLCDPQ
TSGGLLLAVLPDAEADVQAIAAQHGMTLSPIGELTSADSRRALIEIVV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgccagcgatacgtcttactcaatacagccacggagcgggctgtggttgcaag
atttcaccaaaagttttggataaaattttgcatactgagcaacaaaagttttttgatccc
cggttgctggtgggcaatgaaacgcgtgatgatgcagcggtttatgatattggtaacggt
gttggcattatcagcacgactgatttttttatgccgatcgttgatgatccttttgatttt
gggcgtattgccgccacaaacgcgatcagcgatgtatatgctatgggcggtaaacccata
atggctattgctattttggggtggcccattgacaaactggcacccgaaatcgcacagcaa
gtgatcgagggtgggcgatatgtttgccagcaagcggggatttctttggcaggcgggcac
tctattgatgcccctgaacccattttgggtttggctgttaccggaattgtcagcactgaa
caggttaagaaaaacagtgctgcaaagccaggatgcaaactgtttttgaccaagccattg
ggcattggcatcttaacgacagccgaaaagaaaagtaaattacggccagaacatcgggga
ttggcaacggaaaccatgtgtcagttgaataagcccggcgctgattttgcgcatattccc
ggtgttaccgccatgaccgatgtcacggggtttggtctgttggggcatttgagtgaaatt
tgtcagggttctggtgtccaggccattctgcattactctgcgatcccacgtttacctgcc
gttgaagactatattgctgaaggttgtgttccaggggggactgggcgtaatttcgacagt
tatggtcacctgatcggtaatatgtctgatttacaaaaacaattactttgtgatcctcaa
acctctggcggattactgttggcggtcttacctgatgctgaagccgatgtacaggccatt
gccgctcagcacggaatgaccctcagcccaattggtgaattaacctcggcggatagtcgc
cgggcgctgattgagattgtagtgtga

DBGET integrated database retrieval system