KEGG   Yersinia pestis A1122: A1122_15405Help
Entry
A1122_15405       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K06911  uncharacterized protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pirin Pirin_C
Motif
Other DBs
NCBI-ProteinID: AEL73704
Position
3343260..3344129
Genome map
AA seq 289 aa AA seqDB search
MKKVQGIYRAPRQHWVGDGFPVRSMFSYQSHGKQLSPFLLLDYAGPMDFTPTTQRRGVGQ
HPHRGFETVTIVYHGEVEHRDSTGNGGIIGPGDVQWMTAGAGILHEEFHSDAFAQKGGPF
EMVQLWVNLPAKDKMTAPGYQAIRREAIPQVNLPDDAGNLRVIAGEYAGNIGPAKTFSPL
NVWDIRLTQGKSCEFSLPAGWNTALIVLHGTLLVNGDAIAREAEMVLLDPTGTHLSIEAN
NDTVLLLLSGEPIDEPIVGYGPFVMNTQAQIAEAIADFNGGRFGNMDVA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttcaaggtatttaccgtgcacctcgtcaacattgggtaggcgatggcttc
ccagtacgttcaatgttttcttatcaaagtcacggtaaacaactgagtccgttcttgcta
ctggactatgctggccccatggattttaccccgacgacgcaacgccgtggggttgggcaa
catccacatcgtggttttgaaacggtcaccatcgtttatcacggtgaagtcgaacaccgc
gattcaactggtaacggcggtatcattggtccgggtgatgtgcaatggatgactgcaggt
gcaggtattctgcatgaggagttccactcagatgcttttgcgcaaaaaggcggccctttt
gagatggtacagctatgggtcaatttacctgctaaagataaaatgaccgcacccggctat
caggcgattcgtcgtgaggctattccacaggttaatttacctgacgatgcagggaatctg
cgggttattgcaggtgaatatgccggaaacattgggccagcaaagacattttcaccactg
aatgtctgggatattcggttaactcaaggaaagagttgtgagttttcactacccgcaggc
tggaacaccgcactgattgtgttacacggaaccctcttagtgaatggtgatgccattgcc
cgcgaagcggaaatggtactactggatcccacgggcactcatctgagtattgaggccaat
aatgacaccgtgttactgctgttaagcggtgagccaatcgacgagcctattgtcggttat
ggcccatttgtgatgaatactcaggcacaaatagccgaagctatcgctgattttaatggt
ggccgctttgggaatatggatgttgcataa

DBGET integrated database retrieval system