KEGG   Yersinia pestis A1122: A1122_15420Help
Entry
A1122_15420       CDS       T01831                                 

Definition
(GenBank) SpoVR family protein
  KO
K06415  stage V sporulation protein R
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    A1122_15420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoVR
Motif
Other DBs
NCBI-ProteinID: AEL73707
Position
3347381..3348916
Genome map
AA seq 511 aa AA seqDB search
MTTSTSKQTTQDKRLTDGPDWTFELLQVYLDQIDRVAKHYRLDTYPHQIEVITSEQMMDA
YSSIGMPINYTHWSFGKKFIETEQKYKYGQQGLAYEIVINSNPCIAYLMEENTITMQALV
MAHACYGHNSFFKNNYLFRAWTDASSIVDYLLFARHYINECEERYGVEEVERLLDSCHAL
MNYGVDRYKRPQKISLVEETARQKSREEYLQSQVNSLWKTLPRKDREEAPVQAQRYPNEP
QENILYFMEKNAPLLESWQREILRIVRKVSQYFYPQKQTQVMNEGWATFWHYTILNHLYD
EGRVTDRFMMEFLHSHTNVVYQPPYNSPYYNGINPYALGFAMFQDIKQICQSPTEEDYYW
FPDIAGKDWLDTLHFAMRDFKDESFISQFLSPKIMRDFRLFTVLDDDKNNYLEISAIHNE
EGYRTIRNQLSAQYNLSNHEPNIQVWNVDLRGDRSLTLRYIPHDRAPLDKSRQQVMKHIH
RLWGFDVHMEQLNDDGSIDLLDSIPQKTSKI
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttcaacatcgaaacagaccacgcaagataagcgcctgactgacggccctgac
tggacatttgagctactgcaagtgtatctcgaccaaatagatcgggtggcgaaacattac
cggcttgatacttatccccatcagatagaagtgatcacctcagaacaaatgatggatgcc
tattcaagtattggcatgcccattaactatacccattggtctttcggtaaaaaatttatc
gaaactgaacaaaaatataagtacggtcaacagggattagcctacgagattgttattaac
tcgaatccttgtatcgcctacttgatggaagagaataccatcacgatgcaagcactggtt
atggcccatgcctgttacggacataactccttctttaagaataactatttattccgcgcg
tggactgacgccagctccatcgtggactacctactctttgcccgccactatattaatgag
tgtgaagagcgctatggcgttgaagaggttgaacggttgctcgattcttgtcatgcgtta
atgaattatggcgttgatcgctataagcgtccgcaaaaaatttcgctggtcgaggagacc
gcacgccagaaaagccgtgaagagtatctgcaaagccaagtgaattccctgtggaaaacg
ttgccacgtaaagatcgagaagaagctcctgttcaggcacagcgctaccccaacgaaccg
caagaaaatatcctctactttatggagaaaaatgcaccgttgttggaatcatggcaacgt
gaaatattgcgaattgtccgcaaagtcagccagtatttttatccccaaaaacaaactcaa
gtgatgaatgaaggctgggcaacattctggcactacaccattcttaaccatttatacgat
gaaggccgggtcaccgaccgctttatgatggagtttctgcacagccataccaacgtcgtg
tatcagccaccgtataacagcccttattacaacggcattaacccttatgctcttggcttc
gctatgtttcaggatattaaacagatctgtcagtccccgaccgaggaagactattattgg
ttcccagatattgccgggaaagattggttagataccctacattttgctatgcgtgatttt
aaagatgaaagtttcatcagccagttcttatcgccaaaaataatgcgcgatttccgcctg
tttaccgtgttggacgacgacaagaataactacctggagatttcggctattcataatgaa
gaaggttatcgtactatccgcaatcaattgtccgcacagtataacttgagcaaccatgag
ccaaacattcaggtatggaatgttgatctacgtggagaccgctctctaacactgcgttat
atcccgcatgaccgagcgccattagataaaagccgccagcaagtgatgaagcatattcat
cggctgtgggggtttgatgttcatatggaacaattgaatgatgatggcagtatcgatttg
ctcgacagcattccgcagaaaaccagtaagatttaa

DBGET integrated database retrieval system