KEGG   Yersinia pestis A1122: A1122_15425Help
Entry
A1122_15425       CDS       T01831                                 

Definition
(GenBank) fatty acid metabolism regulator
  KO
K03603  GntR family transcriptional regulator, negative regulator for fad regulon and positive regulator of fabA
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypt03000]
    A1122_15425
Transcription factors [BR:ypt03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    A1122_15425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FadR_C GntR HTH_Crp_2 TrmB HTH_IclR FCD Fe_dep_repress HTH_24 PaaX Rrf2 HTH_28 MarR Cut8
Motif
Other DBs
NCBI-ProteinID: AEL73708
Position
complement(3349134..3349853)
Genome map
AA seq 239 aa AA seqDB search
MVIKAQSPAGFAEEYIIESIWNNRFPPGSILPAERELSELIGVTRTTLREVLQRLARDGW
LTIQHGKPTKVNNFWETSGLNILETLARLDHDSVPQLIDNLLAVRTNIATIFVRTAIRHH
PEKAQEILARAKTVDDNAEAFTALDYGIFRGLAFASGNPIYGLILNGLKGLYTRVGRYYF
SNPEARKLALTFYNKLSTLCDTESYDQVLECLRTYGKESGAIWHSMQGTMPSDLAEARR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggttataaaggcgcaaagtcctgccggtttcgcggaagagtatattattgaaagtatt
tggaataatcgctttcctccaggatctattttgcccgcggagcgtgaactttctgagctg
attggtgtgactcgcacaacattgcgcgaagtactacaacggctagcccgcgatggctgg
ctcactattcagcacggtaagccaacgaaagtaaacaatttttgggagacatctggtcta
aatattttggaaacactggcgcggcttgaccatgacagcgttccacaattgatagataac
ttactggctgttcgaaccaatattgccactatttttgtgcggacagctatccgtcatcat
ccagaaaaagcgcaagaaattttggcgcgagcgaaaacagtggatgataacgcagaagcc
tttactgctcttgattatggtattttccgtggtttggcatttgcctcaggcaatccgatt
tatggtttgattcttaacggtttgaaagggctttacacccgagtagggcgttattacttt
tctaatccagaagcgcgcaagctggcactgactttttacaataaactgtcgacgttatgt
gatacagaatcttatgatcaggtactagagtgcctgcgcacatacggcaaagagagcggg
gctatctggcatagcatgcagggcaccatgccaagtgatttggccgaagcgcgtcgttag

DBGET integrated database retrieval system