KEGG   Yersinia pestis A1122: A1122_15455Help
Entry
A1122_15455       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: AEL73714
Position
3356262..3357434
Genome map
AA seq 390 aa AA seqDB search
MRKTSSLFLLFGTLFSAGGYGATFLISAWFHSQGGNDIDAGATLGMALFGTLIGVPLVGW
FAGKLDASRLAALAALIQSCGYFLLGSLSGGSGYLPHVAALLIGLGWGMFYIGGPMALSE
RLTDTERGPGFTRFSAFQMTGICGSPILLTIAVVQGGIPIQAAFLLVGVMGVFASILLMI
FGTREPLIRHENSLRPWVKKITVLAKSGVIRPIVMVCLGGAVFSGMMSFQDSLTDGSLAS
ASTFFAVHATTAVVSRLLLAHKLSSWPRTPLVAVLLCCLMIGLVCLLGIPTHVSFQIAAA
MLTGAGYGLLYPVIQTWAVNESAPENRHAALTWFVVAYFVGIFGFPPFGGWVLVTVGKVW
FIWVLATLATLELVTAIVKWPQTTHRPLSS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaacttcatcactgtttctcctgtttggcacgttgttcagcgcaggaggctat
ggtgccacatttctcatttctgcttggtttcactcgcaggggggcaacgacattgacgct
ggggcaaccctcggtatggctctgttcgggacactcatcggtgtgcctttggttggctgg
tttgctggaaaattggacgcctcacgtctggcggcgctggcagcactgatccagtcctgt
ggctactttctactggggagcctcagtggcggatccggctatctgccccatgtagcggca
ctgttgattggcctgggctggggcatgttctatatcggggggccaatggcgctgtctgaa
cgcctcaccgataccgaacgaggccctggttttacacgcttcagtgcattccagatgacc
ggaatttgtggtagccctatcctgctgactatcgcggtggtacaaggagggatccccatc
caggccgcatttctgttggtgggcgtgatgggagtcttcgcctctatcctgttgatgatt
tttggcacccgagagccacttatccggcatgagaattcactgcggccttgggtaaaaaaa
attaccgtactcgccaaaagcggagtcatcagacccatcgtgatggtctgtttagggggg
gccgttttttctggaatgatgtcgtttcaggactcgctcaccgacggttcattggccagc
gccagtactttttttgccgtgcatgccactaccgccgtggtttcacgcctgttacttgca
cacaaactatcaagctggccccgtaccccactcgtagcggtactcttgtgttgcctaatg
atcggccttgtgtgcctgttaggaataccgacgcatgtgagtttccagatcgctgccgcc
atgctaaccggcgctggctacggtctgttataccccgtgattcaaacttgggcggtcaat
gaatcagcccctgaaaaccgtcacgccgctctgacttggtttgtcgttgcctacttcgtg
ggtatttttggttttccgccttttgggggctgggtactggtgacagtaggcaaggtttgg
tttatctgggtgctggctacgttggccacattagagttagtgacagcgatagtgaagtgg
ccgcaaaccactcaccgcccgctatcatcatag

DBGET integrated database retrieval system