KEGG   Yersinia pestis A1122: A1122_15530Help
Entry
A1122_15530       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_tail_L
Motif
Other DBs
NCBI-ProteinID: AEL73729
Position
complement(3370477..3371229)
Genome map
AA seq 250 aa AA seqDB search
MTINTDLQRLEPGNRVRLYEVDGSKFDGPLLRFHADTLPHTPEEIAAANGDESKLPAKSI
WWQGEEYSAWPVQVEGIEMSSDGQSAQPKLSVANLDGTITALCLAFDDMVQAKVIVHDTF
KHYLDAVNFPEGNSDADPEQEKVQVYYIDSKSTETNEIVEFTLSSPADLQGLLIPTRQIH
SLCTWCMRGDYRSGNGCDYAGTLYFDEKGNPTDDPSKDKCSGLLVDCKKRFGADNPLPFG
GFPGAALIKR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaatactgacttgcaacgactggagccgggtaaccgcgttcgcctgtatgaa
gtggacggctctaaatttgatggcccgttattgcgatttcacgctgacacattaccccat
accccagaagaaattgcagccgccaatggtgatgaatccaaactaccagccaagtctatc
tggtggcagggggaagagtattcggcgtggccggtacaggttgaaggtattgagatgtcc
agcgatggacaaagtgcgcagccaaagttatcggtcgcaaaccttgatggaactatcacc
gcgctgtgtctggcctttgacgatatggtgcaggctaaagttattgttcacgacacgttc
aaacattacctggatgccgtgaacttccccgaaggcaattcggatgcagacccagaacaa
gagaaagtgcaggtttactatatcgacagtaaatcgacagaaaccaatgagattgttgaa
ttcacactttccagcccagcagatttgcaggggctgcttattcctacccggcaaattcac
tccctctgcacctggtgcatgcgcggagactaccgttcaggtaatggctgcgattatgcc
ggtacgctgtacttcgacgagaaaggcaatccgacagatgacccaagcaaggataaatgc
tctgggctgttggtcgattgcaaaaaacgatttggagccgataacccattgccgtttggt
gggttccccggcgcggccctgatcaagaggtag

DBGET integrated database retrieval system