KEGG   Yersinia pestis A1122: A1122_15560Help
Entry
A1122_15560       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_tail_3 Big_2
Motif
Other DBs
NCBI-ProteinID: AEL73735
Position
complement(3376593..3377513)
Genome map
AA seq 306 aa AA seqDB search
MGFALPNGAGIYLAKTYETEVAVTAVSNAVDAVLTVATGHDIAEGDIVQLTSSWGALNDL
AAKVTASTTTSLTLGSIDTSNTDRFAVGGGVGTVKKIASWIEIPQITEVANSGGDQQMIQ
IQFLSDTRQRNLNTFKAAQSQTLTLAHDYSQPVYPVLRAADESEQTLATYMYVPKAKENR
YSTVKVSFNDIPTTAINAIETVAVVFNLQSQAMTFYKAGIAVPVTGVTLNKTTTILAVAA
TETLTATVAPANATNKSGAWSSSAPTKATVDPVTGVVTGVAAGSVNIIYTTADGAKTATC
AVTVTA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgcacttccaaacggggcaggtatttacctggctaaaacatatgaaacagaa
gtggcggtaacggcagtttccaatgctgttgacgcagttctgactgtagctacagggcat
gacatcgcagaaggcgatattgtgcaacttacgtccagttggggcgctctgaatgatctg
gctgccaaagtgacggcatcaacaacgacttcgctaaccctcggttcaattgatacatcc
aatactgaccgttttgctgtaggtggcggtgtagggacggttaagaagatcgcaagttgg
attgaaatcccgcaaatcaccgaagtggctaacagcggcggcgatcaacagatgattcag
attcaatttctgagcgatacccgtcagcgcaacctcaacacgtttaaagctgcacagtct
caaaccctgacgctggcgcatgattacagtcagccggtttatccggtattgcgtgcggct
gatgagtcagagcaaacactggcaacctacatgtatgtgcctaaagccaaagaaaatcgc
tactcaacggttaaagtgtcatttaacgatatcccgaccacggcaatcaatgccatcgaa
acagtggcggtggtattcaacctgcaatctcaagccatgaccttctataaggctgggata
gcagtgcctgttactggtgtcacgttgaataaaactacgactattcttgccgtggctgcc
actgaaaccttgacggcaaccgtagcgccagctaatgcgactaacaaatcaggtgcctgg
tcatcctccgcaccaaccaaagctactgttgacccagtaactggcgttgtaaccggcgtt
gccgcaggcagtgtcaatatcatttacaccacggcagatggcgcgaaaaccgctacttgc
gccgtcacagtaaccgcataa

DBGET integrated database retrieval system