KEGG   Yersinia pestis A1122: A1122_15705Help
Entry
A1122_15705       CDS       T01831                                 

Definition
(GenBank) putative phage excisionase
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1233
Motif
Other DBs
NCBI-ProteinID: AEL73764
Position
3395679..3395939
Genome map
AA seq 86 aa AA seqDB search
MDNVIQMNPSKWVSEDLLMSLNGMTKHMIQHARRKSWMEGREYIHVAPDLNPKENSPIMY
NRQEIDNWVERQRPAIRRRIGERISA
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggataacgttattcaaatgaacccaagcaaatgggtttcagaagacctgctcatgtct
ctgaatggcatgacaaaacacatgatccaacacgcccgccgaaagtcatggatggaagga
cgtgaatacatacacgttgcacctgacctaaacccaaaagagaacagcccaataatgtac
aacaggcaggaaattgataattgggttgaaaggcagcgaccggcaatccgcaggaggatt
ggcgagaggatttctgcttaa

DBGET integrated database retrieval system