KEGG   Yersinia pestis A1122: A1122_15715Help
Entry
A1122_15715       CDS       T01831                                 

Definition
(GenBank) transposase for insertion sequence
Organism
ypt  Yersinia pestis A1122
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve HTH_7 HTH_38 HTH_23 Sigma70_r4_2 TnsD HTH_29 HTH_3 HTH_24 HTH_28 HTH_11 GerE HTH_31 HTH_IclR HTH_26 HTH_Tnp_ISL3 CENP-B_N NUMOD1 GcrA YdaS_antitoxin Terminase_5 HTH_40 HTH_10 HTH_30 RepB HTH_AsnC-type HTH_19 rve_3 Sigma70_r4 HTH_35 HTH_22 Phage_NinH HTH_8 HTH_36
Motif
Other DBs
NCBI-ProteinID: AEL73766
Position
complement(3396886..3397908)
Genome map
AA seq 340 aa AA seqDB search
MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPPKYTPRPAVASLLDEY
RDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSLSVPQEQEPAVRFETEP
GRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDTLETCHRNAFRFFGGVPR
EVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLCRPFRAQTKGKVERMVQYT
RNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANRRKHETIQARPCDRWLEEQQSML
ALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtcacttttgagacagttatggaaattaaaatcctgcacaagcagggaatgagtagc
cgggcgattgccagagaactggggatctcccgcaataccgttaaacgttatttgcaggca
aaatctgagccgccaaaatatacgccgcgacctgctgttgcttcactcctggatgaatac
cgggattatattcgtcaacgcatcgccgatgctcatccttacaaaatcccggcaacggta
atcgctcgcgagatcagagaccagggatatcgtggcggaatgaccattctcagggcattc
attcgttctctctcggttcctcaggagcaggagcctgccgttcggttcgaaactgaaccc
ggacgacagatgcaggttgactggggcactatgcgtaatggtcgctcaccgcttcacgtg
ttcgttgctgttctcggatacagccgaatgctgtacatcgaattcactgacaatatgcgt
tatgacacgctggagacctgccatcgtaatgcgttccgcttctttggtggtgtgccgcgc
gaagtgttgtatgacaatatgaaaactgtggttctgcaacgtgacgcatatcagaccggt
cagcaccggttccatccttcgctgtggcagttcggcaaggagatgggcttctctccccga
ctgtgtcgccccttcagggcacagactaaaggtaaggtggaacggatggtgcagtacacc
cgtaacagtttttacatcccactaatgactcgcctgcgcccgatggggatcactgtcgat
gttgaaacagccaaccgccacggtctgcgctggctgcacgatgtcgctaaccgacgaaag
catgaaacaatccaggcccgtccctgcgatcgctggctcgaagagcagcagtccatgctg
gcactgcctccggagaaaaaagagtatgacgtgcatcttgatgaaaatctggtgaacttc
gacaaacaccccctgcatcatccactctccatctacgactcattctgcagaggagtggcg
tga

DBGET integrated database retrieval system