KEGG   Yersinia pestis A1122: A1122_15765Help
Entry
A1122_15765       CDS       T01831                                 

Definition
(GenBank) ribonuclease D
  KO
K03684  ribonuclease D [EC:3.1.13.5]
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypt03016]
    A1122_15765
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.5  ribonuclease D
     A1122_15765
Transfer RNA biogenesis [BR:ypt03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    A1122_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A_exo1 HRDC
Motif
Other DBs
NCBI-ProteinID: AEL73776
Position
complement(3404773..3405894)
Genome map
AA seq 373 aa AA seqDB search
MNYQLITTNNALQQVCEQARTHAHIALDTEFVRTRTYYPQLGLIQLYDGEQLSLIDPLPI
TEWQPFRALLQDLNVVKYLHAGSEDLEVFLNAFDQMPTPMIDTQVLAAFSGRSLSCGFAM
LVAEFEGVELDKSESRTDWIARPLSEKQCDYAAADVFYLLPLAAKLVEATEAAGRMDAAK
DECLLLCRRRSETLDPELAYREITNAWQLRGHQLACLQKLAEWRLRQARERDLAVNFVVR
EEHLWQVARYQPTSLGELDSLGLSGQEIRYHGRTLLALVAEGNAVPEDQLPPPIANLIDQ
PGYKKVFKDIKALIQSVSERSGLSSELLASRRQINQLLNWHWKLKLSDAQPELLTGWRGD
LLSSELLEILQHY
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgaattatcagttgatcacgaccaataacgcattgcaacaggtctgcgaacaagcccgg
acacatgctcacatcgcgttggatacagagtttgtcagaacgcgcacttactaccctcag
ttgggtttgattcaactgtatgatggtgaacaactctcacttatagatccattacctatc
acggaatggcagccttttcgcgcgttactgcaagatctgaatgtggtgaaatatttacac
gcaggcagtgaagatctcgaagtgtttttaaacgcttttgaccagatgccaaccccgatg
attgatactcaggtattagcggcattttctggccgtagcctatcctgcggctttgccatg
ctggtggctgagtttgaaggtgttgagttagataaaagtgaatcacgtacagactggatt
gcccggccgttgagtgaaaaacagtgcgattatgcggcggctgatgtgttttatctttta
cctctggcggctaaattagtcgaagccactgaggcggcagggcggatggacgcggcgaaa
gacgaatgtctattgctgtgccgccgtcggagtgagacgctcgatcctgaactggcttac
cgtgagattaccaatgcctggcaactccgtggccatcaactggcatgtttgcagaaatta
gccgaatggcgtttacgtcaggcacgggagcgggatttggcggttaactttgtggttagg
gaagagcacctgtggcaagttgcccgctatcaaccaacatcactcggtgagttagattct
cttggcttgagtgggcaggagatccgctatcacgggcgaacattgctggcactggtcgcc
gaagggaatgccgtccctgaagatcagcttcctcccccgattgctaacttgattgaccaa
ccggggtacaaaaaagtctttaaagatattaaagccttgattcaatcggtcagtgaacgt
agcggattaagcagtgaattactggcatcacgtcgccaaattaatcagttactcaattgg
cactggaagttgaagctttcagatgctcaacctgaattattaacaggctggcgtggcgat
ttattgtcttctgaattgcttgaaatcttacaacactattaa

DBGET integrated database retrieval system