KEGG   Yersinia pestis A1122: A1122_15825Help
Entry
A1122_15825       CDS       T01831                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00030  Pentose phosphate pathway
ypt00480  Glutathione metabolism
ypt01100  Metabolic pathways
ypt01110  Biosynthesis of secondary metabolites
ypt01120  Microbial metabolism in diverse environments
ypt01130  Biosynthesis of antibiotics
ypt01200  Carbon metabolism
Module
ypt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ypt_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ypt_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A1122_15825
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A1122_15825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypt04147]
    A1122_15825
Enzymes [BR:ypt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A1122_15825
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A1122_15825
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A1122_15825
  Exosomal proteins of colorectal cancer cells
   A1122_15825
  Exosomal proteins of bladder cancer cells
   A1122_15825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEL73786
Position
complement(3414764..3416239)
Genome map
AA seq 491 aa AA seqDB search
MNTVQVAQACDLVIFGAKGDLARRKLLPSLYQLEKAGHIHPDTRIIGVGRAEWDKDAYTA
VVKEALDTFMKEPLDDELWQKLSSRLDFCNLDVNDSKHFTKLGKMLDQKHRTTINYFAMP
PSTFGAICKGLGEAGLNKEPSRVVMEKPLGTDLAPSRVINDQVAEYFNECQVYRIDHYLG
KETVLNLLALRFANSLFASNWDNRTIDHVQITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILTMIAMSPPADLSTDRIRDEKVKVLRSLRRIDHTNVRETTVRGQYTAGFVQGNKVPG
YLEEEGANKNSNTETFVSIRVDIDDWRWAGVPFYLRTGKRLPSKCSEVVVYFKNPALNLF
RESYQQLPQNKLTIRLQPDEGIEIEVLNKVPGLEHKHRLQTTKLDLSFSKTFNEQHIADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSIMNAWAADNEAPKPYQSGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtccaggtagcccaggcgtgtgacctggtgattttcggcgctaaaggtgat
ttggctcgccggaaactgctgccttctctttaccaattagaaaaagcgggtcatatccac
ccagatactcggataatcggtgttggccgtgctgagtgggataaagatgcgtacaccgct
gtggtaaaggaagccctcgatacctttatgaaagagccgctggatgacgagctatggcaa
aaactcagctcgcgcctcgacttctgcaatctggatgtgaatgacagtaagcatttcacc
aaattaggtaaaatgctcgatcaaaaacatcgcaccacgattaactactttgctatgccg
ccgagtacatttggtgcgatttgtaaaggcctgggagaagccgggttaaacaaagagcct
agccgagtggtaatggaaaaaccattgggaaccgatttagcgccctcaagggtaattaac
gatcaggtagccgagtatttcaacgaatgtcaggtttaccgtattgaccactatttaggg
aaagaaacggtattaaacctgttggcgcttcgcttcgctaactcgttgttcgcctcaaac
tgggacaaccgcactatcgatcatgtgcaaattaccgtcgcagaagaggtcggaattgaa
gggcgttggggctattttgatcaggccggtcagatgcgtgacatgatccaaaaccatctg
ttgcaaatcctgacgatgatcgccatgtcaccccccgcagatctcagtacggatcgcatc
cgtgatgaaaaagtaaaagtactgcgttcgctgcgccgtattgatcacaccaatgtgcgc
gaaactacagttcgtgggcaatatactgccggctttgtacagggcaataaagtgccgggt
tatctggaagaggaaggcgcgaataagaatagcaataccgaaacatttgtgtctattcgg
gtggatatcgatgactggcgttgggctggggtacctttctacctgagaaccggtaagcgc
ctacccagcaaatgctctgaagttgtggtttactttaagaaccccgcactgaatctcttc
cgcgaatcttatcaacaactgccacaaaacaaactgacaattcgtttgcaaccggacgaa
gggatcgaaattgaagtgctgaataaagtccccggattggaacataagcatcgtttacaa
accactaagcttgatctcagtttctccaaaaccttcaatgagcagcatattgctgatgcc
tatgaacgtctgctactggagaccatgcggggtattcaagcgctgtttgtgcgccgtgat
gaggtcgaagaggcgtggaaatgggtcgattctattatgaatgcgtgggcggcagataat
gaagcaccaaaaccataccagtccggtacatgggggcctgtggcatccgttgctatgatc
acccgtgatggccggtcatggaatgagttcgagtaa

DBGET integrated database retrieval system