KEGG   Yersinia pestis A1122: A1122_15830Help
Entry
A1122_15830       CDS       T01831                                 

Definition
(GenBank) DNA-binding transcriptional regulator HexR
  KO
K19337  RpiR family transcriptional regulator, carbohydrate utilization regulator
Organism
ypt  Yersinia pestis A1122
Brite
Transcription factors [BR:ypt03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    A1122_15830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS SIS_2 MarR HTH_24 HTH_29 HTH_Tnp_ISL3 HTH_23 HTH_Crp_2 Penicillinase_R TrmB HTH_11 MarR_2 NTP_transf_3 HTH_36
Motif
Other DBs
NCBI-ProteinID: AEL73787
Position
3416601..3417470
Genome map
AA seq 289 aa AA seqDB search
MNTLENIQNSMDLLSKSERKVAEVILASPQTAIHSSIATLAKMANVSEPTVNRFCRRLET
KGFPDFKLHLAQSLANGTPYVNRNVEEDDSVAAYTGKIFESTMASLDRVKNNLDIAAINR
AVDLLTQAKKISFFGLGSSAAVAHDAMNKFFRFNIPVIYFDDIVMQRMSCMNSSEGDVVV
LISHTGRTKSLVELAQLARENDAAVIAITSCDTPLANEATLSLLLDVPEDTDMYMPMVSR
IAQLTLIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKDSLPVNNGD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgctggaaaatatccaaaatagtatggaccttctgagcaaatcagaaaggaaa
gtcgccgaggtaatccttgcctccccgcaaacggccatccattctagtatcgctacactt
gccaaaatggcgaatgtcagcgaaccgacagtcaaccgtttttgccgtcgtctggagacc
aaaggtttccctgattttaaactgcatttggcgcaaagtctggcgaacggtacaccctat
gtgaatcgtaacgtcgaagaagatgatagtgtagctgcgtacaccggaaaaatttttgaa
tcgacgatggccagcttggaccgcgtaaaaaacaatctggatatcgccgccattaaccgg
gctgtcgatttattgactcaagcgaaaaaaatctcgttctttggcctgggttcctccgct
gccgttgctcatgatgcgatgaataagtttttccgctttaatatcccagtaatttatttc
gatgacatcgttatgcaacgcatgagttgtatgaactcaagcgaaggcgatgtggtagtg
ttgatctcccacacagggcgaaccaaaagcctggtggagctggcgcagttggctcgtgaa
aatgatgctgccgtgattgccataacttcatgtgatacgccactggccaacgaagcaacc
ttatcgctgttgctggatgtgccggaagataccgatatgtatatgccaatggtgtcacgc
atcgcccagctcacgttgattgatgtgctggcaacgggcttcaccctacggcgcggagca
aaatttagggataatttgaagcgggttaaagaggcattgaaagaatctcgttttgataag
gattctttgccagtaaacaacggtgattaa

DBGET integrated database retrieval system