KEGG   Yersinia pestis A1122: A1122_15850Help
Entry
A1122_15850       CDS       T01831                                 

Definition
(GenBank) putative peptidase
  KO
K19304  murein DD-endopeptidase [EC:3.4.24.-]
Organism
ypt  Yersinia pestis A1122
Brite
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     A1122_15850
Peptidases [BR:ypt01002]
 Metallo Peptidases
  Family M23
   A1122_15850
Peptidoglycan biosynthesis and degradation proteins [BR:ypt01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   A1122_15850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 OapA OapA_N LysM Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEL73791
Position
complement(3420816..3422132)
Genome map
AA seq 438 aa AA seqDB search
MQQIVRTITLAYNNLPRPHRIMLGSLTVMTLAVAVWRPFIYHPEHEPVAKSVVLDTSQSR
ILLPEASEPLDQPTPDDAIPQDELDTKDANDTGVHEYVVSTGDTLSSILTQYGIDISDVS
LLANQNRDLRNLKIGQQISWTVNDTGDLQSLTWEVSRRETRTYNRVGNNFKETKELQKGE
WKNSVLTGRLDGSFVGSAKKAGLTAAEIRAVTKALQWQLDFSKLRKGDQFAVLMSREMLD
GRSEQSQLVGVRMRSGGKDYYAIRAEDGKFYDRQGSGLARGFLRFPTLKQFRVSSNFNPR
RLNPVTGRIAPHKGVDFAMPVGTPVLAVGDGEVLISKFSGAAGNYVVIRHGRQYTTHYMH
LKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQAVNPLTAKLPRSEGLSGKD
RSEYLAIVKQVIPQLQLD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagatagtcagaactatcactttagcatataacaatcttcctcgaccccatcgc
atcatgttggggtcgttgactgtaatgacactggccgtcgctgtttggcggccttttatc
tatcacccagagcatgaacctgttgccaagagcgtggtgctagataccagtcaatcccgc
attttattgccagaagccagtgaacctctcgatcagccaacgcctgacgatgcaatccca
caagatgaattagacaccaaagatgccaatgacactggtgtccatgagtatgttgtgtca
acgggtgatacgttgagcagcattcttacccagtatgggattgatatctctgatgtttct
ttattagcgaaccaaaaccgtgacttacgtaatctgaagatcgggcagcaaatctcctgg
acagtgaatgacaccggtgatttacaaagcctgacttgggaagtgtcgcgtcgcgaaact
cggacgtataaccgtgttgggaacaatttcaaagagactaaagagctgcagaaaggcgag
tggaagaacagtgttctgacgggccgtcttgatggtagttttgtcggcagtgcgaagaaa
gcagggctgacagccgctgaaattcgtgccgtgaccaaggcactacagtggcaattagat
ttcagtaagctgcgtaaaggcgatcagtttgcggtcttaatgtcacgggaaatgctggat
ggtcgcagtgagcaaagccagctcgttggggtacgcatgcggtctggaggtaaagattat
tatgctatccgggctgaagatggcaaattctatgatcggcagggctctggccttgcacgt
ggtttcctacgtttccctacactgaaacaattccgtgtctcatccaattttaaccctcgt
cggttaaatccggtgactgggcgtattgcgccgcataaaggcgtggatttcgcgatgcct
gtcgggacaccggtattagccgtgggcgatggcgaagtcttaatctcaaaattcagtggt
gctgccggtaactatgtggttatccgccatggtcgccaatacaccacgcattacatgcat
ttgaaaaaattgctggttaaacccgggcagaaagtaaaacgtggtgaccgtatcgcgttg
tcgggtaataccggccgttcgactgggccacatctgcattatgaattttggatgaaccag
caagcggttaatccactgacagctaaattgccacgttcagaagggttgagtggtaaagat
cgcagtgagtatttggccattgttaagcaagttattccgcagttacaactggattag

DBGET integrated database retrieval system