KEGG   Yersinia pestis A1122: A1122_15855Help
Entry
A1122_15855       CDS       T01831                                 

Gene name
znuA
Definition
(GenBank) high-affinity zinc transporter periplasmic component
  KO
K09815  zinc transport system substrate-binding protein
Organism
ypt  Yersinia pestis A1122
Pathway
ypt02010  ABC transporters
Module
ypt_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A1122_15855 (znuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypt02000]
    A1122_15855 (znuA)
Transporters [BR:ypt02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    A1122_15855 (znuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA
Motif
Other DBs
NCBI-ProteinID: AEL73792
Position
complement(3422153..3423109)
Genome map
AA seq 318 aa AA seqDB search
MLHKNKWLKQAMLASALLLANPFNLASAAVVTSIRPLGFIAAAIADGVLPTEVLLPDGAS
PHDYALRPSDVQRLRSAELVIWVGPEMEAFLSKPLTQVAENKQIALSQLPSVTPLLMKSD
EHDEAEEGESGHHHDHAKDNPTDDHHHGEYNMHIWLSPAIAKQAAIAIHDRLLELTPQNK
DKLDANLRRFEYQLAQNEKNIVTMLKPVQGKGYFVFHDAYGYFENHFGLSPLGHFTVNPE
IQPGAQRLHQIRTQLVEHKAVCVFAEPQFRPAVINAVAKGTNVRSGTLDPLGSGIVLDKD
SYVNFLSQLSNQYVSCLK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttacataaaaataaatggctaaaacaggcaatgctcgccagcgcacttttactggca
aatccctttaatctggcttcggcggccgttgttacatcaatacgcccgctaggttttatt
gctgccgccattgcagatggggtgctgccaaccgaggttttattacctgatggcgcatct
ccccacgattatgcgcttcgtccatcggatgtccagcggttacgtagcgccgaattggtt
atttgggtcgggccggaaatggaagcatttctatcaaaaccattaacgcaagtcgctgaa
aataaacagatcgctttatcacagttaccttctgttacaccattgttgatgaagagtgat
gaacatgatgaggctgaagagggcgagagtggacatcatcatgatcatgctaaagataat
ccgactgatgaccaccatcacggtgagtataacatgcatatttggctgtcaccggccatc
gctaaacaggctgcaattgctatacacgacagattattggaacttacgccacaaaataag
gacaaattagatgcgaacctgcgtcgattcgagtatcaactagcgcaaaatgaaaaaaat
attgttactatgcttaagcctgtccaaggtaagggatattttgtttttcatgacgcctat
ggctactttgaaaatcactttggcttgagtccattagggcattttacagtcaatcctgaa
atacaacctggtgcgcagcgtttacatcaaattcgaacacagttggttgagcataaggcg
gtatgcgtttttgctgaaccacaattcaggccagcggtcattaatgctgttgccaaggga
actaacgtgcgttctggcacactggatcctttagggagcggtatagtattggacaaggac
agctatgtgaactttttgtctcagttgtcgaaccaatatgtgagctgcctgaagtaa

DBGET integrated database retrieval system