KEGG   Yersinia pestis A1122: A1122_15890Help
Entry
A1122_15890       CDS       T01831                                 

Gene name
nudB
Definition
(GenBank) dihydroneopterin triphosphate pyrophosphatase
  KO
K08310  dihydroneopterin triphosphate diphosphatase [EC:3.6.1.67]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00790  Folate biosynthesis
ypt01100  Metabolic pathways
Module
ypt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A1122_15890 (nudB)
Enzymes [BR:ypt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.67  dihydroneopterin triphosphate diphosphatase
     A1122_15890 (nudB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AEL73799
Position
complement(3428374..3428817)
Genome map
AA seq 147 aa AA seqDB search
MNYKRPESVLVVIYAKSSGRVLMLQRRDDPDFWQSVTGSLEEGEAPLQTAQREVKEEVGI
DILGENLVLLDCQRCVEFELFAHLRRRYAPGITRNKEHWFCLALPEERDIVITEHLAYQW
LDAAEAAVLTKSWSNQQAIEEYVLYSV
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaattataaacgccccgagtcggttctggtcgtcatctatgccaaatccagcgggcga
gtgttgatgttgcaacggcgcgatgatcctgatttttggcagtcggtgaccggcagtctg
gaagagggggaggctccgttgcaaaccgcacagcgcgaagtaaaggaagaagtcggcatt
gacattctgggtgaaaatctggtgttgctcgactgtcagcgctgtgtggagtttgaactc
tttgcgcatttgcgccgtcgctatgctccgggaattacgcgtaacaaagaacattggttc
tgtttggcgttgccggaggagcgggatatcgtgattactgagcatctcgcctaccagtgg
ttggatgcggcagaggctgccgtattgaccaagtcctggagtaatcaacaagcgattgaa
gagtatgttctttattccgtctag

DBGET integrated database retrieval system