KEGG   Yersinia pestis A1122: A1122_15950Help
Entry
A1122_15950       CDS       T01831                                 

Definition
(GenBank) putative oxidoreductase
  KO
K03810  virulence factor
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    A1122_15950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEL73811
Position
complement(3447814..3448725)
Genome map
AA seq 303 aa AA seqDB search
MKKLRVGIVGLGGIAQKAYLPILTQAQGWQLVGAFSPNQAKAQPLCDSYRMRYFSRLDTL
AAASDAVFVHSSTASHFQVVHDLLQAGVHVYVDKPLAETREQSEQLIELADKQHLALMVG
FNRRFAPLYQQLKQQASSPVSLRMEKHRLSSIGPHDLGFTLLDDYLHVVDTALWLGGEGA
RLTGGAVQTNAQGQMLYAEHHFQQGGCLITTSMHRQAGTQRESVQVISDGACYHITDMRQ
WQQASAGQVISQPAPGWQTTLEQRGFTGAVHHFIEAVSNQTRPQVSGEDAIVAQRMIERI
LQQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactacgcgtgggtatcgtggggctggggggcattgcgcaaaaggcttatttg
cctattttaactcaggcgcagggttggcaactggttggcgcattttcacccaatcaagct
aaagctcaaccgctatgtgatagctatcgtatgcgttatttttcacgcttggatacgctc
gctgcggcaagtgatgccgtttttgtccatagtagtaccgccagccattttcaggtcgtg
catgatttattgcaggccggagtccatgtctatgtggataaacccctggctgaaacacga
gagcaatcagagcaattgatcgaactggcagataaacagcatttagcgctgatggtgggt
tttaatcgccgttttgccccgttatatcagcagttgaaacaacaggcgagcagcccggtc
tcactgcggatggagaagcaccggctaagtagcatcgggccacacgacttaggttttacc
ttgctcgatgactatctgcatgtcgtggatacggcgctgtggctaggcggtgagggggca
agattgacgggtggggcagttcagaccaatgctcaggggcagatgctgtatgcggagcac
catttccagcaaggtggttgtttgatcaccaccagtatgcaccgtcaggccggaactcag
cgggaaagcgtacaagttatcagtgacggtgcctgttatcacattaccgatatgcgccaa
tggcagcaggcgtcagcggggcaggtgataagccaacctgctcccggctggcaaacgaca
ttggaacaacgtggttttaccggggctgtgcatcatttcattgaggcggtcagtaatcaa
acgaggccgcaagtctcaggtgaagatgcgattgttgcacaacgtatgattgagcgtatt
ttgcagcagtag

DBGET integrated database retrieval system