KEGG   Yersinia pestis A1122: A1122_18480Help
Entry
A1122_18480       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ypt  Yersinia pestis A1122
Pathway
ypt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1122_18480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypt02044]
    A1122_18480
Secretion system [BR:ypt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1122_18480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN DUF1980
Motif
Other DBs
NCBI-ProteinID: AEL74313
Position
complement(3970987..3971568)
Genome map
AA seq 193 aa AA seqDB search
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIK
VLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLL
ASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLE
LGNNSLTLRTEKK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaccgtttggaaaaataaaacctgtacttcgaaacataaaagctgggccgcc
tggaaaaataaaatctgcatccccgcactggtcttgttgctcagtggctgcgggctgacg
caagccgtgaccgatagcaccgtgtcggccacaaaatcactgttttataagcagataaag
gtgctgcatctggactttaccgcccgtgaagccctgaataccgatgcgcacgaggcgaac
tcgtcatcggagccggtaatggtgcgggtttatcagttacgtgatgataaaaccttcctc
aaaacggtgtatcaacaactggcaagcgacggggaggcggcgcttaaagatgacctgctg
gccagccgcagtgtggtggtgaaaccgggcggggcggtaacactggatatgccgatggaa
aaagagacccagtttgtggcagtggtggcgctgttccgtcatccggatatggccaaagac
cactggcgtctgatactcacgctggacgacctgcatcccgataagccccgtacccttgag
ttgggtaataacagcctgaccctgcggacggagaaaaaataa

DBGET integrated database retrieval system