KEGG   Yersinia pestis A1122: A1122_18510Help
Entry
A1122_18510       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypt  Yersinia pestis A1122
Pathway
ypt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1122_18510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypt02044]
    A1122_18510
Secretion system [BR:ypt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A1122_18510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C T3SS_needle_reg DUF2271 Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: AEL74319
Position
complement(3977767..3981189)
Genome map
AA seq 1140 aa AA seqDB search
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGTPQRDRWLTGLVVGT
GILTLCALLSYAGTRLSGRKHFDELRQQAQGDDAPLPEDNAQAGETQQGEPSRLKTRLRR
RYGLFWRDKVRLLMVVGEPDEIAALAPQLAEQGWLEGQRTVLIHGGSLQRPADETGLSEW
RKLRRGRPLDGIVWAMTAAQSGTPQWMDNGLRTLEKMGAALRYQPPVYLWQVCDSDWPQD
SRTEQPVGAVFPAKATPEKVEQQLRALLPQLREQGMQQLSIEPHHDFLLRLAQSLDQGDA
ARWRQRLTPWFTEYAARIPLRGLMFSLPDTSASAAQVHEKSWTVPASWQGVLDDCRGARG
RRVGLPWEQTLCYSLLALIVLWGVGSVVSFAVNRHQMVSAAQQAQQLAQSHAVSDQQLMA
LQALRNDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLYQK
LSELAELPANSPQRAARAKTGYDQLKAYLMMARPEKADAVFYAQVMQTTEPTRAGVSPGL
WQSLAPDLWQFYAQNLPAQPDWKITPDTGLISQVRQVLLGQMGQRNAESTLYENMLLSVR
RNYADMTLMDMTGDTDAQRLFQTSESVPGMFTRKAWDEQIQQAIDKTVASRREEIDWVLS
DNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHWNEAHNLSDVIDQLTLMSDVR
QSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGGPVGPLDETFG
PLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASDPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVA
NWKSAFDGRYPFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPNKVN
SQGLTFNPAFLAAINQLSQISDILFTDGSQGLRFELLARPVPNVVETNLAIDGQKLHYFN
QMESWQSFRWPGETYKPGTMLTWTGVSSGARLYGDYQGTWGLIRWLEQAKQKKLDEGRYQ
LTFTTADKQPLQWILRTELGKGPLGLLQLRNFTLPAQIFLIQHAPLAIADMSDDEDMAED
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcattgccttaccgattaaaaagccagaagtctggttctggattgttgccctg
ctgtttttgctggccggtgccgtgttgtgctggctggtctggcaacaccccgaacgggtg
gggttaattccggggacaccgcaacgtgaccgttggctgacgggactggtggtgggaacg
gggatcctgaccctgtgcgcattactgtcgtatgcggggacccggttatccggcagaaaa
cactttgatgagctacggcagcaggcacagggcgatgatgcgccgttgccggaagacaac
gcgcaggcgggtgagactcagcagggtgaaccgtcccgcctaaaaacccgcctgcgccgc
cgttacggtctgttctggcgcgacaaagtccggctgctgatggtggtgggtgaacctgac
gaaatcgccgcgctggccccgcaactggcggagcagggctggctggaagggcagcgcacg
gtgttgatacacggtggcagtttacaacgtccggcggatgaaaccgggctgagtgagtgg
cgcaaactgcgccgtggccgcccgttggatggcattgtctgggcgatgaccgccgcgcag
agtggcacgccacagtggatggataacggcctgcgaacgctggaaaaaatgggtgccgcc
ttgcgctatcaaccgccggtgtatctgtggcaggtctgtgacagcgactggcctcaggat
tcgcggacggagcagccggtcggggcggtgttcccggcgaaggctacgccagaaaaggtg
gagcagcaactgcgtgccctgttgcctcagttacgtgaacagggaatgcagcagctttcc
atcgagccgcaccatgatttcttgttgcgtctggcgcagtcactggatcagggcgatgcg
gctcgctggcggcagcgtctgacgccgtggtttaccgagtatgccgcgcgtattcccttg
cgtgggctgatgttcagtttacccgatacctctgcatcggcggcgcaggtacatgagaaa
agctggacggtaccggccagttggcagggggtactggatgattgccggggggcgcgtgga
cgccgtgtcgggctgccgtgggagcagacactgtgctacagcttgctggcactgattgtc
ttgtggggtgtgggcagcgtggtgtcatttgcggtcaaccgccaccagatggtctctgcc
gcacaacaagcacagcaactggcgcagtcgcacgcggtctccgaccagcaactgatggcc
ctacaagccctgcgaaatgatatcgggcgcttacaatctcgcgtggcgcagggcgcgccg
tggtatcagcgctttggtctggaccataatgcgccgctgcttgaggtcctgatgccgtgg
tatggtcaggccaacaaccgtattctcagggatgccaccgcgcagagcctgtatcagaaa
ctcagcgaactggcggagctgcccgccaacagcccgcaacgggcagcacgggcaaaaaca
ggctatgaccagttaaaggcttatctgatgatggcccgcccggaaaaagccgatgctgta
ttttatgctcaggtgatgcagaccaccgagcctacacgggccggtgtctcccccggtctg
tggcagagtctggcgcccgacttgtggcagttttatgcacaaaatctgcccgctcagccg
gactggaaaattaccccggataccgggttgatcagccaggtgcggcaggtgttgctgggg
cagatgggtcagcgcaatgcagaaagtacgctgtatgaaaacatgctgctgtcggtgcgc
cgcaactatgccgacatgacgctgatggacatgaccggcgataccgatgctcagcgtctg
tttcagacctcggaatccgtgcccggtatgttcacccgcaaggcctgggatgagcaaatc
cagcaggcgatagataaaacggtggcctcccgccgcgaagaaattgactgggtattgagt
gataaccgccgggcgatatccgaagatatctcaccggaagcgctgaaaaaacgcctgacc
gaacgttatttcaccgattttgctggcagttggctgagtttcctcaacagtttgcactgg
aatgaggcgcataacctgtcggatgtgattgaccaactgaccttgatgagtgatgtacgc
cagtcgccgctgattgcgctaatgaacacgctggcgtggcaagggcagaccgggcagcag
aatcaggcattatcggattcgctggtgaagtctgccaaggcgctgatgaataaagaccag
gctccggcgattgaccagagtgccggtgggccagtagggccactggacgagacctttggc
ccgttgctggcactgatgggcaaaggcgatgcacaaaacaggctgtcgtcggacagctcg
ctgagcctgcaaacgttgctcacccgcgtgacccgggtgcggcttaaactccagcaggtg
gtcaatgcttcggatccgcaggagatgacacaggtgctggcccagaccgttttccagggc
aaaagtgttgatctgacggacacgcaggagtacggcagcctgatagccgccagtctggga
gaggagtggagcagcttcgggcagacgatgtttgttcagccgctgacgcaggcgtgggaa
accgtgctgcaaccttcatcggccagtctcaacgaccagtggaaaaacgcggtggtggcc
aactggaaatcggcctttgatggccgctatccgtttgccgccagtaaaagtgatgcttca
ttgccgatgctggccgagtttatccgcaaggacagcgggcgcatcgacagcttcctgacc
cgtgaactgggcggcgtgctgcacaaagaaggaacgcgctgggtgccgaataaggtgaac
agccaggggctgacctttaacccggccttcctggcggcgattaatcaactgagccaaatc
tccgacatcttgttcactgacggcagtcaggggctacgctttgagctgctggcccgtccg
gtgccgaatgtggtggaaacgaatctggcgattgacggacagaaattgcattatttcaac
cagatggagagctggcagagtttccgctggccgggggagacctataaacccggcacgatg
ttgacctggactggtgtgagttcaggcgcccggttgtacggtgattatcaggggacatgg
gggctgatccgttggctggagcaggcaaaacagaaaaagctggatgaagggcgctatcaa
ctgaccttcaccaccgcagataaacagccattgcaatggatattacgcaccgagctgggc
aaaggcccgttaggcctgttgcaactgcgtaatttcactctgcctgcgcaaatttttctg
atacagcacgcgccgcttgcgattgctgacatgtcagacgatgaagacatggcagaagac
tga

DBGET integrated database retrieval system