KEGG   Yersinia pestis A1122: A1122_18580
Entry
A1122_18580       CDS       T01831                                 

Definition
(GenBank) hypothetical protein
Organism
ypt  Yersinia pestis A1122
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: AEL74333
Position
complement(3996801..3998537)
AA seq 578 aa
MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSD
PLFAGLATENGLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFAR
QLLWQRPEWAAQLAVMMVVNPQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTV
ATSVARDTVWLSQQQTPPLTLWSTVSTPGSLADWQRAESRAVQAERLKQAVLFSSQHDWL
NAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLWQHWLAAHTTLTQVAGWHPPP
PAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAWQNRQLLHRVA
FDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVV
AGHTDITGDAQANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRA
LNRRVEISLVPQADACQVPDVKTASQDESDVSTQEMEK
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgagtcggtggtggcaacgtgggttgtggctctgggcgggtttgctggcggtcatcttg
tgtctggcatttctgccgctctccccgtgggggcgctggctgatgctggcatgggtggtg
ctgatttgcatgctgggcgggtcgcgggcagggcggcaagcggccggtgcatcctctgat
ccgctgttcgccgggttggcaactgaaaacggtcttctgcctgaaaacagtcgcttaccg
gtggtgttggtatgtggtgatggtctggcgtcatggtttggtcgcgaacggtcacaccag
agtgcacagggctgctggctgcgggtggatgatatcagcaccctgcggcagtttgcccga
caactgctgtggcaacggccggaatgggccgctcagttggcggtgatgatggtcgtgaac
ccgcagcaacgccgcgatgagcgcctgctggccgccgatctgcaagagctgcgctggcaa
ctgatgcaactgcgccgcgatagccgccatcctgttcccttgctcctgagcagcacggtg
gccacctcggttgcccgtgatacggtctggctgtcacagcagcagacaccgccgctgaca
ctctggtcaaccgtctcgacgccgggctctctggccgactggcagcgtgcggaaagccgt
gccgtacaggccgaacgactgaaacaggcggtgctgttcagcagccagcatgactggctg
aacgcacaggtgctgccggtattgcaggcacccaatgcggatgttgccccccttgccccg
caacagattattcaacagcaggttgccagtctggccgatccggtgcctgcctcgctgtgg
cagcactggctggcggcgcataccacgctgacacaggtggcgggttggcatccaccgccg
cccgccgcccatgacgccttaccgctgccggattttgtcttttcagcgcttcctcttggt
agcggggtgtcgtcacgccgtcgggtactgcgccatggtgtcaccttactgacgttggcg
gcgatggtggcgttgtgcagcagcgcctggcagaaccggcaactgttgcaccgggtggcc
tttgatatccgtcagtaccacagcgtggcgatgacggattattccccgaaagcgcaggcg
gtggcggtattacgccgtgatgcggggctgcttgatgaagggtaccgcaacggtgaaccg
ctgcgtctgggcctggggttatatcggggggagcggctgcgcccgccgctgttggcggcg
atcaaaagctacatcccgccccctccgccccctcccgcgccaccggcgccgaaaaccgtg
cgcctcgacagcctgtcactgttcgatgtgggtaaattcacgctgaatgcggggtccacc
aaaatgctggtcacggcgctgatcgacatcaaagccaaacccggctggctgatcgtggtg
gccgggcataccgacatcaccggcgatgcgcaggccaaccacattctgtcgcttaagcgc
gccgaagcattacgcgactggatgctgtcaaccagcgacgtctcgccgacctgctttgcg
gtgcaaggttacggggccacacgccctatcgccgacaacgatactcccgacggtcgggcg
ctcaaccgccgggtcgaaatcagtctggtaccacaggctgatgcctgtcaggtgccggat
gtaaaaacagcgtcacaggatgaaagtgacgtatcaacgcaagaaatggagaagtaa

DBGET integrated database retrieval system