KEGG   Yersinia pseudotuberculosis MD67: BZ21_2980Help
Entry
BZ21_2980         CDS       T03677                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu00270  Cysteine and methionine metabolism
ypu00920  Sulfur metabolism
ypu01100  Metabolic pathways
ypu01110  Biosynthesis of secondary metabolites
ypu01130  Biosynthesis of antibiotics
ypu01230  Biosynthesis of amino acids
Module
ypu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BZ21_2980 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BZ21_2980 (metA)
Enzymes [BR:ypu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BZ21_2980 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     BZ21_2980 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AJJ01858
UniProt: A0A3G5IWJ6
Position
complement(3379550..3380479)
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLIVTGAPLGLVDFCDVAY
WPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVKLSGIYQHQTLEPLALLT
RGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLFASKDKRVAFVTGHPEYDV
DTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHGHLLFANWLNYYVYQITPFD
LRHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcgggttcctgatgaattacctgcagtgagtttcttgcgcaatgagaatgtt
tttgtgatggcttcatcgcgtgctaaaactcaggaaattcggcccctgaaggtattgatt
ttaaatctgatgcctaaaaaaattgagacggagaatcaattcctacgtttactctctaac
tcgccactccaggttgatattcaattgttgagggttgatagtcgtgagtctaaaaatacg
cctacggagcatctgaacaacttttactgcgattttgaggacattcaggaccagaatttt
gatggcttgatcgtaaccggcgctcctctgggtttagtcgatttctgtgatgtggcttat
tggccacaaattgaacgtattattgcctgggcaaaagagcatgtgacatcaactctattt
gtctgttgggcggtgcaggcggcgttaaatatcttgtatggcatcccgaagatgacgcgc
gaggtcaaactctctggtatctatcagcatcaaacactcgaaccgctggccttattgacg
cgtggttttgatgaaacatttctggctcctcattcccgctatgctgattttcccgttgaa
gtccttcaacaatatactgatttggatatcttagtgtcgtcagaagaggctggggcttat
ctgtttgccagtaaagataagcgggtggcttttgttaccggtcatcctgagtatgatgtc
gatacgttagcgggtgaatatcagcgtgatctggctgcaggccttaacccacaagttcct
cttaattatttcccttctgacgatgcatcgttacgaccaaaagcatcatggcgcagtcat
gggcatctactgtttgccaattggctcaactactatgtttaccaaattacgccatttgat
ttgcgacatatgaatcctacccttgattga

DBGET integrated database retrieval system