KEGG   Yersinia pseudotuberculosis MD67: BZ21_3097Help
Entry
BZ21_3097         CDS       T03677                                 

Definition
(GenBank) HAMP domain protein
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZ21_3097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypu01001]
    BZ21_3097
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypu02022]
    BZ21_3097
Enzymes [BR:ypu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BZ21_3097
Protein kinases [BR:ypu01001]
 Histidine kinases
  OmpR family
   BZ21_3097
Two-component system [BR:ypu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BZ21_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AJJ01986
UniProt: A0A3G5KFY8
Position
complement(3479677..3481029)
Genome map
AA seq 450 aa AA seqDB search
MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
RLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSDQMAQQLGGPT
DVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLAVGGAWLFIR
IQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQMAAGVKLLSDDRTLLMAG
VSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAIIEQFIDYLRTGQEMPTEPSD
LNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRALTNMVVNAARYGNGWIKVSS
GKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARSTSGTGLGLAIVQRIIDAHAGSL
EIGTSKRGGLRIRAYIPLPLDVKPKPPAVA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggtggcgcttttctccacgtagttcattcgcccgaaccttattactgatcgtg
accttgctgtttgtcagtttggtcactacgtatctggtggtgctgaatttcgctatctta
cctagcttgcaacagttcaataaagtgttggcgtatgaagtccgtatgctgatgactgat
cggctgcaattggaagatggcacactacttgaagtcccgcccgcgttccggcgtgagatt
taccgtgagttgggtatttcgctttataccaacgcggcggcagaggaaagtggcctacgt
tgggcacagcattataaatttctcagtgatcaaatggcccagcagttgggcgggccaacc
gatgtccgggtcgaggtcaataaaaactcacctgtagtttggctcaaaacctggctgtcg
ccagatatctgggtgcgcgtccccctcacggagattcaccaaggcgatttctcgccgctg
ttccgttataccttggccattatgctactggcggtgggtggggcctggttatttatccgt
attcagaatcggcctttggtggaactggaacatgcggctttacaggtcggtaaggggaat
attccgccaccgttgcgggaatacggtgcttctgaagttcgctcggtgacacgggcattt
aaccaaatggccgccggggtcaaattgttgtctgatgaccggaccttgttgatggcgggc
gtgagccatgatttacgtactccgttgacgcgtattcgcttggcaacggaaatgatgagt
gaagacgacgcttacctgtctgaatcgatcaataaagacattgaagagtgcaatgcgatt
attgagcaatttatcgactatctgcgcaccgggcaggagatgccgaccgaaccgagcgat
cttaattctgtattaggtgaagtgattgcggcagaaagtggttatgagcgggtgattgag
acggatttagctgaaggtgaagtgttggtggatattcatccattatcgattaaacgcgcg
ctaaccaatatggtggtgaatgcggcccgttacggtaatggctggataaaagtgagcagt
ggtaaggagttgcagcgggcttggttccaggttgaagatgatggccccggtataaaaccc
gaggatttgaagcacttgctccagcctttcgtgcgcggtgatagtgcccgcagcaccagc
ggtactgggctaggcctggcaattgttcagcgaatcattgatgcgcacgcggggtcattg
gagattggtaccagtaagcgaggcgggttacggatccgcgcatatattccattgccattg
gatgtgaagcccaagccaccagcggtggcttga

DBGET integrated database retrieval system