KEGG   Yersinia pestis Shasta: BZ15_2363Help
Entry
BZ15_2363         CDS       T03718                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ypv  Yersinia pestis Shasta
Pathway
ypv00350  Tyrosine metabolism
ypv00360  Phenylalanine metabolism
ypv00380  Tryptophan metabolism
ypv01100  Metabolic pathways
ypv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BZ15_2363
   00360 Phenylalanine metabolism
    BZ15_2363
   00380 Tryptophan metabolism
    BZ15_2363
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypv04147]
    BZ15_2363
Enzymes [BR:ypv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     BZ15_2363
    4.1.1.105  L-tryptophan decarboxylase
     BZ15_2363
Exosome [BR:ypv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZ15_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJJ52915
UniProt: A0A2S9PKV2
Position
complement(2593366..2594781)
Genome map
AA seq 471 aa AA seqDB search
MTPEEFRRHGYAMIDLIADYRQNIELRGVNPTTAPGEIKSRLSLNAPEKAEPFEHIISDI
EELIMPGLLHWQHPDFFGYFPSNVELSSVLGDCLSTGLGVIGLSWQSSPALTEIEEVATN
WLLKMLGLSVAWSGVIQDSASTATLVALISGRERTSNYALMNKGMQNSDAPLIVYTSSEA
HSGVNKAALLAGFGHNNTRLVPTDEHNAMSPLALKKIIQQDLVKGNRPCIVVATTGTTAA
TAMDPLDAIGDITQRYGLWLHVDSAMAGSAMILPECRHLWCGIEKADSVVINPHKWLGAA
FDCSVYCVQDSEHLIRIMSTNPSFLQSDADGKVRNYRDWGIPLGRRFRALKLWFLIREQG
VEGLQARLRRDIANANWLAEQIKNSDDWKLVAPVVLQTLCIRHEPGGLMGDALDNYTRSW
AEKLNQSGKGYVTPATLGGRWMVRVSIGTLGTERHHVEKLWLLLQSLVKER
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgaagagtttcgccgccatggctatgccatgatcgacctgattgctgattac
cgacaaaatatcgaattgcgtggcgttaatcccacgacagcacccggtgagattaaatct
cgtctgtcgttaaatgcacctgaaaaagcagaacctttcgaacacattatttctgacata
gaagagctcatcatgccagggctattgcattggcaacatcctgacttttttggttatttt
ccttctaatgtagagttatcctccgttcttggggattgcttgagtactgggctgggggtg
ataggtctgtcttggcaatccagcccggccctgacagaaattgaagaggtggccaccaat
tggttgctaaaaatgcttggtcttagcgttgcctggagtggcgtgattcaggattccgcc
tcaaccgccacgttagtggcgctgatcagcggccgagagcgaacatctaactatgcatta
atgaataaagggatgcaaaacagtgatgcacctttgattgtctacacttcatcagaagcc
catagcggagtgaataaagccgctctgctcgctgggtttggtcataataatacccgttta
gtgcccaccgatgagcacaatgccatgtcacccttggcattaaaaaagatcattcaacag
gatttggtgaagggaaaccggccttgtatcgttgttgctacgacaggtactaccgctgcg
acagcgatggatccccttgatgcgattggtgatattactcagcgttatggtttatggctg
catgtggattctgctatggctggttcagcgatgattttgccagaatgccgtcatctgtgg
tgcggtatagaaaaggctgattctgtggtgataaatccgcataaatggctgggtgctgct
tttgattgttcggtttattgtgtacaagattcagagcatttgattcgtatcatgagtact
aaccccagtttcttacaatccgatgccgatgggaaagtgagaaattaccgcgattggggg
atccccctgggtcgtcgttttcgtgcgcttaagctatggtttctaatccgtgagcaaggg
gtggaagggctgcaggcgcgtttgcgtcgtgatattgccaatgctaattggttagcagaa
caaattaaaaacagcgatgattggaaactggtcgcacctgtagtgttgcaaaccttgtgt
attcgtcatgaaccgggtgggctgatgggcgacgcgttggataattatacccgcagttgg
gccgagaaactcaatcaatctggtaagggttatgttacaccagccacgcttggtggccgc
tggatggtgcgggtttccatcggcactttgggtacggaacgtcatcacgttgagaagttg
tggttgttgttgcagtctttggttaaggagagataa

DBGET integrated database retrieval system