KEGG   Yersinia pestis Shasta: BZ15_2551Help
Entry
BZ15_2551         CDS       T03718                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypv  Yersinia pestis Shasta
Pathway
ypv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BZ15_2551 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ypv03400]
    BZ15_2551 (recD)
Enzymes [BR:ypv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BZ15_2551 (recD)
DNA repair and recombination proteins [BR:ypv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BZ15_2551 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 SH3_13 UvrD-helicase DUF2075 PhoH AAA_22 AAA_16 UvrD_C AAA_28 CbiA T2SSE MukB FtsK_SpoIIIE AAA AAA_33 MeaB Flavi_DEAD SRP54 TrwB_AAD_bind NTPase_1
Motif
Other DBs
NCBI-ProteinID: AJJ51693
UniProt: A0A2S9PIH0
Position
complement(2775517..2777475)
Genome map
AA seq 652 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAAPTGKAAARLTESLGKAIR
QFFLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNAGEYRQ
ALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFGRYQLL
CALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLFNGDIG
IALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFM
PVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcgattacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattaaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctttcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactaaccaataaggcattagccaataaagcgcagccagatgaaacc
tattctgattcagcgaatgtacgcgatagcctgtgtttactgcgtaaaagttaccgcttc
gatgaaaagtcagggattgggcagcttgctctggccgttaatgcaggggagtatcggcag
gctttatccgtattaaacagtgcgtattctgatgttgaacgcttcccgctggccgatgag
gaagattatcaggtactgctagaggcttgtgctgtggggtatcagcattacctcgaacgg
gtggctgcgttagcccctgcggcagaggtattggcagcatttggccgctaccaactgctg
tgtgcattacgttccgggccattcggtgtcagtggcttaaacgaacgcattgaacaggtt
ttacatcgtaaaggattcattatccgtccatcagggccttctggccgttggtatgttggg
cggccagtgatgatagaacttaatgatagcgcacttggcttattcaacggggatattggt
attgccttacatgataatgaaggcgagctacgggtatattttcaattgcccgatggcaat
ataaagtcagtacaacctagtcgccttcccagccatgaaaccgcttatgctatgacggtt
cataaatcgcagggttcagagtttgaacacacagcattggtattacctaacacgttcatg
cccgtgttaactcgtgaattggtctataccgccattacccgcgcccgtcagcatctgacg
ctttattgcagcgatgccgtgctaagtcatgccatacgtacaccgactctccggctgagt
gggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system