KEGG   Yersinia pestis PBM19: CH59_1848Help
Entry
CH59_1848         CDS       T03716                                 

Gene name
ccmA
Definition
(GenBank) heme ABC exporter, ATP-binding protein CcmA
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ypw  Yersinia pestis PBM19
Pathway
ypw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CH59_1848 (ccmA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypw02000]
    CH59_1848 (ccmA)
Enzymes [BR:ypw01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     CH59_1848 (ccmA)
Transporters [BR:ypw02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    CH59_1848 (ccmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_23 ABC_ATPase AAA_30 MMR_HSR1 TsaE FeoB_N AAA_16 Ploopntkinase3 AAA_15 IstB_IS21 DUF815 DUF2813 DLIC AAA_27 AAA_22
Motif
Other DBs
NCBI-ProteinID: AJI92633
Position
complement(2106759..2108240)
Genome map
AA seq 493 aa AA seqDB search
MLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKSTLIKALTGVYKRSAGEVLL
DGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGREPLRWGLIDHNKMNQQAAK
LLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLILDEPTASLDAKEVSMLLDIL
CQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTKTVAELPRIELVQMMLGHSFDE
QLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPGEIVGLAGLLGSGRTETAQLIFG
ITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRKTEGIVGAATVRENIILALQAQRG
WLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLSGGNQQKVLLARWLATKPRFLILDE
PTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELEELAGYADRIIVLRDRRHVAQLDHDE
ISVPAIMQAIAVQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttagaagtccgtggcttatctgttgagtttcctggtgttaaggcattggactccgta
gatttttctctgcaacgcggtgaggttgttgcgttattaggagagaatggcgcaggaaaa
tcgacattaataaaagcattaaccggggtttataaacgatccgctggtgaggtgctgttg
gacggcaaggctgtgtgccccattgataccgcagatgcccaactcatggggattggtact
gtctatcaagaggtcaacttactgccgaacatatctgttgctgcgaatttatttattggc
cgtgagccgctacgttgggggctaattgatcacaataaaatgaaccagcaagcagcaaaa
ttgctgacgggttatggtttaacgttagatgttcagcagcctttggctaatttctctatt
gcaatacaacagattgtagcaatcgcccgcgccgttgacctttccgcgaaggtgctgatt
ctggatgagcctacagcaagtttagatgctaaagaagtcagtatgttactggatatcttg
tgccagctacgggaccagggtatcggtatggtttttgtgacccattttctcgatcaggtt
tatcgaatcagtgatcgcattacagttttgcgaaatggcaagctcgtcggtaccaaaact
gtggcagaacttccccggattgagctagtgcaaatgatgctggggcatagttttgatgaa
caattactgaaacgtggtgaacacagtattacgaataagaatccattggttgagtttaaa
aactatggccgacggggtgtggtagagaattttgatttgtctgtatctcccggtgaaatt
gtcgggttggccgggttattaggttcaggacggactgaaacagcacagctaatttttggc
ataacgacacctgatacgggggaagccaaaatacaaggcaaaccggttaaaattagaaca
ccacgtaaggcatcaaaatttggttttggctactgcccagaagatcgcaaaacagagggt
attgttggtgcggcaaccgtaagggaaaacatcattttagccttacaagcgcagcgtggg
tggctgaggcccctttctatgcgtgagcagacacaaattgcagacgattttatccagcaa
ctgggtattcgtaccccaagccctgaacagcaaattcaatatctctccggtggaaaccaa
caaaaagtattacttgcccgctggcttgccacgaaaccccgatttttaattttagatgaa
ccgactcgtggtatcgatgtaggtgctcacgccgaaattattcggttgatcgaaaagttg
tgtgatgaagggttggcgctgttaattatctcttccgaattagaagaattggcgggttac
gctgatcggatcatcgttcttcgtgatcgtcggcatgttgctcaactcgaccacgatgaa
atttccgttcctgccattatgcaggcgatcgcggtgcaataa

DBGET integrated database retrieval system