KEGG   Yersinia pestis PBM19: CH59_3071Help
Entry
CH59_3071         CDS       T03716                                 

Definition
(GenBank) HAMP domain protein
  KO
K02484  two-component system, OmpR family, sensor kinase [EC:2.7.13.3]
Organism
ypw  Yersinia pestis PBM19
Brite
KEGG Orthology (KO) [BR:ypw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypw01001]
    CH59_3071
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypw02022]
    CH59_3071
Enzymes [BR:ypw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CH59_3071
Protein kinases [BR:ypw01001]
 Histidine kinases
  OmpR family
   CH59_3071
Two-component system [BR:ypw02022]
 OmpR family
  Unclassified
   CH59_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_3 HATPase_c_2 THOC7 Baculo_PEP_C SKA2 HisKA_3
Motif
Other DBs
NCBI-ProteinID: AJI90850
UniProt: A0A2S9PBG2
Position
3426761..3428110
Genome map
AA seq 449 aa AA seqDB search
MRGRLFWKILLGFWLTFILMTQMLWVIFSFYGHRHEPPENDLVRQIARLQVVSAASVLHT
GGQPALNAMMADWPEADKKYFSVLPAEMADTAEKDISALSGEEPKLYSSEIVTWVTAPDK
ENYRVSYDIEGLRAANLANAPDKHRREILNVPIPMIWMGVLGGLFFSTLLAWNLTRPMRQ
LRVGFERVAQGDLSVRLLPVMRRRHDELTEVARDFDSMAERLQALVSAREQLLHDVSHEL
RSPLARLQLAIGLAHQNPDNVDNALQRIEHESERLDKMIGELLALSRAENHSLADDDEYF
DLQELVKVVVNDARYEAQLPGVEIQLEVAAQSEYTVKGNAELMRRAIENIVRNALRFSAS
GQQVKVTLSALDKRYQIQVADQGPGVEENKLSSIFDPFVRVKSAMSGKGYGLGLAITHKV
ILAHGGQVEARNGEQGGLVITLRVPRWQA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggaagattattctggaaaatcctgttgggtttttggctgacgtttattttgatg
actcagatgttgtgggtgattttttccttttatggtcatcgccatgagccaccagagaat
gacctcgttcggcagattgcccggttgcaggttgtttcagccgcatcagtattacatacc
ggcggtcagccagccttaaacgctatgatggctgattggccagaagcggacaaaaaatat
ttttctgtcttacctgccgagatggcagatacggcagaaaaagatatatcggctctctct
ggggaagaacctaagttatacagtagcgaaatcgtcacttgggtcaccgcacctgacaag
gaaaactaccgtgtcagctacgacattgaaggtttacgcgcagcaaacttggcaaatgcc
cctgataaacatcgccgtgaaatactgaatgttcctatcccgatgatctggatgggggta
ttagggggcttatttttcagtacgttattagcctggaacttgacacggcccatgcgccaa
ttacgtgtcggttttgaacgggtagcacagggggatttatctgtgcggttgcttccagtg
atgcgccgtcggcatgatgaactcacggaagtcgcgcgggactttgactcgatggccgaa
cgcctacaggcactggtcagtgcacgtgagcaattattgcatgacgtttctcatgaatta
cgttctccactagcccgtttacaattggctatcggtttagcgcatcagaaccctgacaac
gtagacaacgcattacagcgcatcgagcatgagtccgaacggttggataagatgattggt
gaattattggcgctatcgcgtgctgaaaatcacagcctggccgatgatgatgagtatttt
gacttacaggaattagttaaagtcgtggtgaatgatgcccgctacgaagcacaactgccg
ggagttgaaatccagttagaggtcgcggcacagagtgagtataccgtaaaaggtaatgct
gaactgatgcggcgtgctatcgaaaatattgtccgcaatgcgctacggttttcagcaagt
ggccaacaggttaaggtgacgctctctgcgctggataagcgctatcaaattcaggttgca
gaccaaggcccaggggttgaggaaaacaaactatccagtatttttgacccttttgttcgt
gttaaatcagcgatgtccggcaaaggatacggcttggggctggcgattacgcataaggtg
attctggctcatggcggtcaggttgaggcgcgaaatggagagcagggtggtctggtgata
acattacgtgtgccacggtggcaggcctga

DBGET integrated database retrieval system