KEGG   Yersinia pestis PBM19: CH59_3417Help
Entry
CH59_3417         CDS       T03716                                 

Definition
(GenBank) ubiE/COQ5 methyltransferase family protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ypw  Yersinia pestis PBM19
Brite
KEGG Orthology (KO) [BR:ypw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ypw03009]
    CH59_3417
Enzymes [BR:ypw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CH59_3417
Ribosome biogenesis [BR:ypw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CH59_3417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Ubie_methyltran Methyltransf_23 Methyltransf_32 MTS Methyltransf_12 PCMT Methyltransf_29 RrnaAD PrmA Methyltransf_9 FtsJ Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: AJI89568
UniProt: A0A3N4B1V1
Position
complement(3778273..3779112)
Genome map
AA seq 279 aa AA seqDB search
MSYQCPLCHQALQLSQQQWCCSNNHQFDCAKEGYVNLMPVQHKGSKQPGDSPEMMQARRA
FLDAGYYQPLQQRVSEILDEALPLDATRLLDIGCGEGYYTAAVADRLNKLRQMAIFGLDV
AKVAVRYGAKRYHQVNFCVASSHRLPFANGALDAVLRIYAPCKAVELARTVKPGGIVVTV
APGPRHLYQLKALIYAQVQLHDDTEEHLDGFELIRRETLAYDMKLTGEQGFNLLQMTPFA
WRASVDTGQKLAAQPSFSCETDFVISLHRRKTDNPQNDI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcagtgtcctctctgtcatcaagcactgcagcttagccaacagcagtggtgt
tgtagcaataatcatcagtttgattgcgccaaagagggctatgtcaatttaatgccagta
cagcataaaggctccaaacaacccggcgatagcccagagatgatgcaagcacgccgggct
tttcttgacgctggctattatcagcctttgcaacaacgggtaagcgagattctggatgag
gctttgccgcttgatgcaaccaggttattggacatcggttgcggtgaaggttattacacg
gcggcggtggctgatcggctaaataagttgcgccaaatggctatttttggtctggatgtg
gcaaaagtcgcggtaagatatggggctaaacgctaccatcaggtcaatttctgtgtggct
tccagccatcgtttaccttttgccaatggtgcactggatgccgtattacgcatttatgcg
ccttgtaaggcggtggaactggcccgcacggtaaagcctggcgggatcgtggttaccgtg
gcacccggccctcgccatctctatcagttaaaagcacttatttatgctcaggtgcaactg
catgatgatacagaagaacatcttgatggttttgagttaatccgccgcgaaacattggcc
tatgacatgaaactcacgggtgagcagggttttaatttattacagatgaccccgtttgcc
tggcgagcatcggttgatactgggcagaaattggccgctcaaccgtcttttagttgcgag
actgatttcgtcatttcactgcatcgtcgtaaaacagacaatcctcagaacgatatttaa

DBGET integrated database retrieval system