KEGG   Yersinia pestis PBM19: CH59_821Help
Entry
CH59_821          CDS       T03716                                 

Definition
(GenBank) RNA pseudouridylate synthase family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ypw  Yersinia pestis PBM19
Brite
KEGG Orthology (KO) [BR:ypw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypw03016]
    CH59_821
Enzymes [BR:ypw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CH59_821
Transfer RNA biogenesis [BR:ypw03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CH59_821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJI91082
UniProt: A0A380PM74
Position
complement(925021..925794)
Genome map
AA seq 257 aa AA seqDB search
MLEIIYQDEHIVAVNKPAGWLVHRSWLDRNETVFVMQTVRDQIGQHVYTVHRLDRPTSGV
LLMALSSDVARMLSLQFEQHQIQKTYHAVVRGYVLEGGTVDYAMAEELDKIADKFAKSDK
APQPSVSHYEALAQVEVPLAIGRYETARYSLVALKPETGRKHQLRRHMAHIRHPIIGDST
HGDLRQNRGVAQHFGCSRLMLHASHLHLNHPVTGEALTLTARWDEPWQGLMSQFGWSGIA
PHLERVEFPLTASQDNE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattatctatcaagatgaacacattgttgcggtgaataagcctgccggttgg
ttagtgcatcgtagttggttggaccgcaatgaaacggtatttgttatgcaaacggtacgt
gatcagattggtcagcatgtgtataccgttcatcgccttgatcgcccgacatcaggcgta
ttgctcatggcattgtccagtgatgtggctcgtatgttgtcgttacaatttgagcaacac
cagattcagaaaacgtatcatgcggtggtgcgcggatatgtattggaaggtggcaccgtt
gattacgcgatggccgaagagctggataaaatagcggataagtttgctaagtctgataag
gctccacagccttctgtcagccattatgaagcattagcgcaagtggaagttcctttggcg
attggccgctatgaaactgctcgctatagcttggtggcattgaaaccggaaacgggtcgt
aagcaccagttgcgtcggcatatggctcatatccgtcaccccattattggtgacagtaca
catggtgatttacgtcagaacagaggtgtcgctcagcattttggttgttcacggttgatg
ctgcatgccagccatttacacctcaatcaccctgtgaccggtgaagcgctgacgcttacc
gctcgttgggatgaaccctggcaagggttgatgtcacaatttggctggtcgggtattgcc
cctcatcttgaaagggttgagtttccgctgactgccagtcaggataatgaataa

DBGET integrated database retrieval system