KEGG   Yersinia pestis PBM19: CH59_843Help
Entry
CH59_843          CDS       T03716                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
ypw  Yersinia pestis PBM19
Pathway
ypw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CH59_843 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ypw03400]
    CH59_843 (recB)
Enzymes [BR:ypw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CH59_843 (recB)
DNA repair and recombination proteins [BR:ypw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CH59_843 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 vWA-TerF-like AAA_30
Motif
Other DBs
NCBI-ProteinID: AJI89688
UniProt: A0A2U2H3Q1
Position
complement(945391..949053)
Genome map
AA seq 1220 aa AA seqDB search
MTPTTPQRLEPLALPLYGERLIEASAGTGKTFTIGVLYLRLLLGLGGDAAFRRPLMVEEI
LVVTFTEAATEELRGRIRDNIHGLRIACVRGVSDDPMYQALLAEITDWAVAAAQLLAAER
QMDEAAIYTIHGFCQRMLANNAFESGILFEQTLVQDELPLWRQACADFWRRHCYPLPLVI
ARAVSQEWSGPEALLSDLSAYLQGETPKFRQAPGDDETILSRHQHVVTQIDALKAEWRLA
APELEALISRSGVDKRSYSSKHLPNWLEKVGLWAEQETEDYQLPKELEKFRQSVLLEKTK
KGAAPQHTLFSAIDSIFEQPLTLRDLILARAISEIRFSVQQEKRQRAELGFDDLLSKLDA
ALQQSGGELLAQSIRTRYPVAMIDEFQDTDPQQYRIFHTVYGGQEACALLLIGDPKQAIY
AFRGADIFTYIRARSEVSAHYTLETNWRSSFPMVQSVNRLFSLVNTPFLFEQIPFINVAA
AKKNHDLSFEIKGEKQPALHFWLQPGDGVGVSEYQQVMARQCAAQIRDWLTAGQQGQAEL
LTTKGPKPVQASDITILVRSRAEAALIRDALSALAIPSVYLSNRDSVFETTEAKDLLWLL
QAVLAPEQERALRSAMATGILGLDARMLDALNHDERAWDALVDEFDHYRQHWQRRGVLPM
LREMMARRHLAENLLATPGGERRLTDLLHLGELLQEAASQLDSEHALIRWLAQQIAQPNP
QSDSQQLRLESDRHLVRVVTIHKSKGLEYPLVWLPFIGNFRQQQNVLYHDRHSFEALLDL
NADEESQALAEEERLAEDLRLLYVALTRSVYHCSVGIAPLIKGGRKKQGESDMHRSALGY
LVQHGQPGDAHVLSEKLTELARSSNGDICVSPVEPPDDKPWQPQPEALPELTARHFTRKM
QDYWRVTSYSGLQQSGSTKKLYGSATGDVSQALGAPLQVLLPRLDIDAVGEQAVVTEDDH
LTPHTFPRGAAPGTFLHDLLEPLDFSQPIELAWLSERLQQQGFSEQWAPVLHQWLNDIVQ
TPLTDTGATLAGLSPERKQAELQFYLPIDSLLRAEVLDRLIKQYDPLSRQCPVLDFQQVR
GMLKGFIDLVFCWQGQYYLLDYKSNWLGEDSRAYTVEAMTQAMAEHRYDLQYQLYTLALH
RYLRHRLADYDYQRHFGGVIYLFLRGVDQQHSGHGIFNCRPEQKLIEEMDRLFSGTIGSN
ATASDKSGSNVIHSGERASR
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgacacccacgactccccagcggcttgagccgctggcgcttcccctctatggcgagagg
ctgatagaagcctctgccggtactggtaagacatttaccatcggggtcctttatcttaga
ttgttgcttgggttagggggcgatgctgcattccgtcgccctttgatggtggaggaaatc
ctagtggtgacctttactgaagccgcgaccgaagagctcagggggcgaattcgcgataat
attcatgggttgcgtatcgcttgcgttcggggagtcagtgatgacccaatgtaccaggct
ctattagccgaaatcaccgattgggccgtagccgccgcgcaattattggcggctgagcgt
cagatggatgaagccgcgatttacactattcatggtttctgccaaagaatgctggcaaat
aacgcttttgaatccggcattttattcgaacaaacgttagttcaggatgaactcccgtta
tggcggcaggcctgtgctgacttctggcggcgtcattgttatccgcttcccttagtcatc
gcacgggcggtcagtcaggagtggagcgggccggaggcattactcagtgatctgagtgct
tatttacaaggtgaaacgccaaagtttcggcaagcgcccggtgacgatgaaacgatcctt
agccgccatcagcacgttgtgacacagattgatgcacttaaagcagagtggcgcttagcc
gcccctgaattagaagcattaattagtcgttctggcgttgataaacgcagttatagcagc
aagcacttacccaactggctggaaaaagtaggattatgggcggagcaggaaacggaagat
tatcaattacccaaagaactggaaaaatttcgccagtcggtgttattggaaaagaccaag
aagggagccgccccacaacatactttatttagtgcgatagactcgatatttgaacagccc
ctaacgttgagggatcttattttagcccgagccatcagcgaaatacggttttctgtacag
caggaaaaacggcagcgtgcagagctggggtttgatgatttactcagtaagttagatgcc
gcattacaacaatcggggggtgagttgctcgcccaatctattcgtacccgttatcccgtt
gcaatgattgatgaatttcaggataccgacccgcaacaataccgcattttccacaccgtt
tatggcgggcaagaagcgtgcgctttactgttgatcggtgatcctaaacaggctatttat
gcttttcgtggcgcagatatatttacctatattcgcgcccgttcagaagtaagcgcccac
tacacattggaaaccaactggcgctcttcttttcccatggtgcaatcagtgaacaggcta
tttagtctggttaatacgcctttcttatttgagcaaatcccctttattaatgtcgccgcc
gccaaaaagaatcatgatttatcctttgaaattaaaggagaaaagcaacctgcgctacat
ttttggctgcaacccggtgacggtgttggtgtaagtgagtaccaacaagtaatggctaga
caatgtgcagcgcaaattcgtgattggttgactgccggccagcaggggcaagcagaacta
ctgaccacgaaaggaccaaaaccggttcaggcatcagatataaccatactggtgcgtagc
cgggcagaggccgcattgatacgtgatgcacttagtgcgctggcgatcccatcggtctat
ttatctaatcgtgacagtgtctttgagactacagaagccaaagatctcttgtggttactg
caagccgtgttagcaccagagcaggagcgcgcactacgtagtgctatggctacggggatc
ttggggttggatgccagaatgttggatgcgttaaatcacgatgagcgagcttgggatgcg
ctggtcgatgagtttgatcactatcgccagcattggcagcgccgtggggtattacccatg
ctgcgggagatgatggcccgccgccatttagctgaaaacttgttggcaacacccggtggg
gagcgtcggctgacagatttactacatcttggggaattactgcaagaggccgcctcgcaa
ctggatagtgagcacgcactaattcgctggttggcccagcaaattgctcaacccaatccc
cagtcagatagccaacaattacgcttggaaagtgatcgccatttggttcgagtggttact
atccataaatcgaaagggttggaatatccattagtttggctgccttttatcggtaatttt
cggcaacaacagaatgtgctttaccatgaccgacatagctttgaggctttactcgatctt
aatgctgatgaagaaagccaggctttagctgaagaagaacgtctggctgaggatttacgg
ctattgtatgtcgcgttgacgcgttcggtttatcattgcagcgtgggcattgcaccgctg
attaaaggggggaggaaaaagcaaggcgagagtgatatgcatcgcagtgcgttaggttat
ttggttcagcatggtcaacccggtgatgctcatgttctaagcgaaaagttaactgagtta
gcgcgctcatcgaatggtgatatttgcgtttcgcccgttgagcctcctgatgataaacct
tggcaaccacagcccgaagccttgcctgaacttaccgcccgccattttactcgaaaaatg
caagattattggcgcgtaaccagctattcaggtttacagcagtctggctctacaaagaag
ctgtatggttctgcaacaggggacgtatcgcaggctctgggggcaccattacaggtcttg
ttgccacggttggacattgatgccgtaggtgagcaggcggtggtgacagaagacgatcat
ttaacacctcataccttccctcggggagcggccccagggactttcttacatgatttgctt
gagccattagattttagtcaaccgattgaattggcgtggttgtctgagcggctacagcaa
cagggttttagcgaacagtgggcaccggtgttacaccagtggctaaatgatatagtgcaa
acgccgcttaccgataccggggccactttggctgggttgtcgccagagcgcaaacaggcc
gagctacaattttatctacccatcgatagcctgctacgggccgaggtattagaccgttta
atcaaacagtatgatccactttcccggcagtgccctgtattggattttcaacaggttaga
gggatgctcaaggggtttattgacttggttttttgctggcaggggcaatattacttgctg
gattacaaatccaattggttgggtgaggacagtcgtgcttataccgttgaggcgatgaca
caagcgatggctgaacatcgctatgatctgcaataccaactttatactttggctttacac
cgctatttacgccatcgtttggccgattatgactatcaacgccactttggtggggttatt
tacctcttcttgcgcggcgttgatcagcaacattcagggcacggtatttttaattgccgg
cctgaacagaaactgattgaagaaatggatcgcttattcagtggcacaattggcagtaac
gcaaccgcgagtgacaaaagcggtagcaatgtcattcacagcggcgagagggcatcacga
tga

DBGET integrated database retrieval system