KEGG   Yersinia pestis D182038: YPD8_0437Help
Entry
YPD8_0437         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypx02044]
    YPD8_0437
Secretion system [BR:ypx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD8_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N Inhibitor_I48
Motif
Other DBs
NCBI-ProteinID: ACY61127
Position
530535..531548
Genome map
AA seq 337 aa AA seqDB search
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISE
QANKLLEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNS
GHAAALGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNN
YFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQLRIFLKNNISQLAQLNAPE
HDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEYFQHYEPSHPAPIFIR
RTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgattttaaaacggatggacaataatatgagtgacatatttcctcaagcattattcggc
gttgaatatgatccggcctatggcgagattgagtccatcctctctcaattagatgagtct
gcggaccccctttcccgcccgcatgaaccccctcaaataaactggcaccatatcagtgag
caagccaataagctgctagagcaatgttttgatttacgtgtaatgctttggtttataagg
gcaaatattcatataaaaggaatatcggccctctatgatggctttatgcgcattaatgca
caaacccaagatactgatgttgttatctaccctcaatcggaagaaccgccattaaatagt
gggcatgccgccgcattaggttggttatctacagcacaatgtattgcagagcttaagact
gcacgccttacagaagagcacccttacattttacaagatcttattacgactgaagcgtta
cccaatggccaagagagatattttgttacatcttcgacattatttttaactgtcaataat
tatttccaacagaatggattgccagatttaaaagaccaattgacaaaagtagatatgttg
ttggaacaaattgagtcctatgcaaatcaatccacagagagttaccaactgcattgtgaa
caattacgtattttcttaaaaaataatatttctcagcttgcacaattgaatgccccagaa
catgacgatcccgaaactgtttatcaaaaaatagacagtcatgaatctcttgatactcag
tcctttaattcaaatgataagagcattcgctcacggcaagagatcattatgatgctggac
cgtattctagagtactttcaacattatgagcctagtcatccagccccaatattcattcgc
cgtaccaaagagatgataggtatggatttttattccattgttgaagaaattctgcctgaa
gctgtaattacattaaaacagtttaccggaaaaactaacctaccgtttcgatga

DBGET integrated database retrieval system