KEGG   Yersinia pestis D182038: YPD8_0440
Entry
YPD8_0440         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypx  Yersinia pestis D182038
Pathway
ypx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPD8_0440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypx02044]
    YPD8_0440
Secretion system [BR:ypx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPD8_0440
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACY61130
Position
533793..534311
AA seq 172 aa
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEF
RMVSNKASPKLFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLG
KGDAVFTDTVLPTDAISLNFARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcagctttagtcgattactttctccatatcgaaggtgtagatggtgagtctcccgat
cagcagtataacggatggatccaagtacaggcttggcaatgggcggaggagaatgcgggg
cgctgggggctaggtggcggtggtggttctgggaaagtcgaaatgaaggacttcgaattt
cgcatggtgagtaacaaagcatcaccaaaactatttttgatgtgtgccatcggtgaacac
attccgcaggccaagttggtgtgtcgtaaatcaggtcaaggtcaacaagacttcctgatt
gttaccttcagtaactgtctggtgtcctcctttaaaactgtcggcaacatgcctcttggt
aaaggggacgcagtattcaccgacacggtgctgccaacggatgccatcagccttaacttt
gcacgtatcgaagtggaatacaaagagcagcaacctgatggctcgatgggggccgtgatt
aaggctggttacgatctgaaattgaacagccgtatttaa

DBGET integrated database retrieval system