KEGG   Yersinia pestis D182038: YPD8_1141Help
Entry
YPD8_1141         CDS       T01833                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00010  Glycolysis / Gluconeogenesis
ypx00260  Glycine, serine and threonine metabolism
ypx00680  Methane metabolism
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
ypx01120  Microbial metabolism in diverse environments
ypx01130  Biosynthesis of antibiotics
ypx01200  Carbon metabolism
ypx01230  Biosynthesis of amino acids
Module
ypx_M00002  Glycolysis, core module involving three-carbon compounds
ypx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPD8_1141 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YPD8_1141 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPD8_1141 (gpmA)
Enzymes [BR:ypx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YPD8_1141 (gpmA)
Membrane trafficking [BR:ypx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YPD8_1141 (gpmA)
Exosome [BR:ypx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YPD8_1141 (gpmA)
  Exosomal proteins of melanoma cells
   YPD8_1141 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACY61826
Position
1479386..1480138
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKTWKLNERHYGALQGLNKSETAEKYGDEQVKQWRRGFA
ITPPALEKSDERFPGHDPRYAKLTDAELPTTESLALTIERVIPYWNDVIKPRIASGERVI
IAAHGNSLRALVKYLDDLGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagctagttttggtacgacacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgaaaaaggccgttctgaagcaaaggca
gcgggtaagctgttaaaagatgaaggcttcacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggaacattttggatgaattagatcaggcatggctgcca
acagaaaaaacctggaagcttaacgagcgtcactacggcgcactgcaaggcctgaataaa
tctgaaacggctgaaaaatacggcgatgagcaggttaagcaatggcgtcgtggctttgcc
atcacccctccagcactggagaaaagcgatgagcgtttcccaggccatgacccacgttat
gcaaaattgactgatgctgagctgccaaccacagaaagcttggcgctgactattgaacgc
gtgattccctactggaatgacgttatcaaaccacgtattgccagcggtgaacgcgtaatt
attgctgctcacggtaactctttacgtgcattggtaaaatatctggatgatctgggcgaa
gacgaaattcttgagctgaacatcccaactggcgtgccattagtgtatgagtttgatgag
aacttcaagcctatcaaacactactatctgggtaacgctgatgaaatcgccgctaaagct
gcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system