KEGG   Yersinia pestis D182038: YPD8_1550Help
Entry
YPD8_1550         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00051  Fructose and mannose metabolism
ypx01100  Metabolic pathways
ypx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YPD8_1550
Enzymes [BR:ypx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     YPD8_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: ACY62233
Position
complement(1978493..1979770)
Genome map
AA seq 425 aa AA seqDB search
MTIITALRTEDVRFPTSLELDGSDAMNPDPDYSAAYVILDTDNPALSGHGLTFTIGRGNE
ICCVAIHALEHLIVGRDLASMTANMGKFWREFTSDSQLRWIGPEKGAIHLATGAVINAVW
DLWSKAEGKPLWRLVADMSPEELVRCIDFRYITDCITPEEALTLLQQRAHNKALRLEKLQ
DEGYPCYTTSAGWLGYPDDKLRRLCQDAVDAGFDYLKLKVGRDLEDDIRRVRITREVLGP
DRKLMIDANQIWETNEAIPWVNQLAFANPWFIEEPTNPDDIEGHRRIRQGVAPVKVATGE
MCQNRIMFKQFIMREAIDVVQIDACRLGGVNEVLAVMLMAAKYDLPVCPHAGGVGLCEYV
QHLAMIDYLCIAGTDKGRVIEYVDHLHEHFVHPCVIKNAAYMPPEQPGFSIEMHQSSIEK
YRFRV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaataatcactgcattacgcactgaggatgtacgttttcccacctcgttggaattg
gatggttcggatgcaatgaatcccgatcctgactattcagcagcctatgtgatcttagac
accgataatccggcactcagtggccacggtctgacgttcaccatcggacgtggtaatgaa
atttgctgcgtggccatccatgcattggaacatctgatcgttggccgtgatttagcgtca
atgactgccaatatgggtaagttttggcgtgaatttaccagcgacagccagttacgttgg
atcggcccggagaaaggcgcgattcatctggccactggcgcggtaatcaatgccgtatgg
gatttatggagtaaggcggagggcaagccgctgtggcgtttagtggccgatatgtcccct
gaagagttggtgcgctgtattgattttcgctacatcaccgactgtattaccccggaggag
gcattaacgctgttgcagcagcgagcgcataacaaagccctacggctggaaaaattgcaa
gacgaaggctacccttgctataccacgtcagcgggctggttggggtatcccgatgataag
ttacggcgcttatgtcaggacgcggtggatgccggttttgactatttgaaactcaaagtg
gggcgtgatctcgaagacgatattcgccgggtgcgcattacccgtgaggtgcttggtcct
gatcgtaaactgatgattgacgccaatcagatctgggaaactaacgaggctattccgtgg
gtgaatcagctcgcgtttgccaatccgtggtttattgaggaacccactaacccggatgat
atcgaaggccatcgtcgtattcgtcaaggtgttgctccggtcaaagtggcaacgggcgaa
atgtgccagaaccgcattatgttcaaacaattcatcatgcgcgaagccattgacgtggtg
caaatagatgcctgccggttaggcggggtcaacgaagtgttggcggtaatgctgatggcg
gcaaaatacgatctgccagtgtgtccacatgccggtggtgtcgggttatgtgagtatgtg
caacacctggcgatgattgactacctgtgtattgccggaacggataaagggcgagtgata
gagtatgtcgatcacttacatgagcattttgttcacccgtgtgtgattaaaaacgcggcc
tatatgccacccgagcaaccgggtttctccatcgaaatgcatcaatcgtcgatagagaag
taccgttttcgcgtttaa

DBGET integrated database retrieval system