KEGG   Yersinia pestis D182038: YPD8_1595Help
Entry
YPD8_1595         CDS       T01833                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00450  Selenocompound metabolism
ypx00970  Aminoacyl-tRNA biosynthesis
ypx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    YPD8_1595
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YPD8_1595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypx01007]
    YPD8_1595
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypx03016]
    YPD8_1595
Enzymes [BR:ypx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     YPD8_1595
Amino acid related enzymes [BR:ypx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   YPD8_1595
Transfer RNA biogenesis [BR:ypx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YPD8_1595
 Prokaryotic type
   Other AARSs
    YPD8_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1f tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACY62278
Position
2035790..2037640
Genome map
AA seq 616 aa AA seqDB search
MLKAQQMGIEPEQMIAEMSQEHQQDFAGFAISYDNYHSTHSDENRELSSLIYGRLKANGY
IKNRTISQLYDPEKGMFLPDRFVKGTCPKCKAPEQYGDNCEVCGATYSPTELIDPKSAVS
GATPVMRESEHFFFDLPAFSDMLQAWTRSGALQEQVANKMQEWFDSGLQQWDITRDAPYF
GFEVPDAPGKYFYVWLDAPIGYMGAFKNLCDKRGDLDFDEFWGKDAKTDLYHFIGKDIVY
FHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKAGTYLKYLDADCLRYYY
AAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFAGQLADQLADPVLYK
TFTDAATSIADAYNNRESGKAIREIMALADVANRYVDEQAPWVVAKQEGRDADLHAICSM
GINLFRVLMTYLKPVLPSLTERTEAFLNTELTWDSIEQPLLGHSITAFKALFNRIDLDKV
NEMVASSKEDMAPATRVTGPLADDPIQETISFDDFAKVDMRIALIQQAEFVEGSDKLLKL
TLELGGETRQVFSGIRSAYPDPKALEGRMTVMVANLAPRKMRFGVSEGMVMAAGPGGSDI
FLLSPDSGAQPGMQVK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagctcagcaaatgggtattgaaccagagcagatgattgccgaaatgagccag
gagcaccaacaggatttcgccggttttgctatcagttatgataactatcactccacccac
agtgatgaaaaccgtgaactgtcgagcctgatctatggccgtctgaaagccaacggttat
ataaagaaccgtactatttctcagctctatgatcctgagaaaggcatgtttctgcccgat
cgtttcgtgaaaggcacttgcccaaaatgcaaagccccggaacagtacggcgataattgt
gaagtctgtggcgcaacctacagcccaactgaacttatcgaccccaaatccgccgtttct
ggtgcgacaccagtgatgcgtgaatctgaacacttcttcttcgatttaccggctttcagt
gacatgttgcaagcctggacacgctcaggtgcgctgcaagaacaagtcgcaaacaaaatg
caggaatggtttgattccggcctgcaacagtgggatatcacgcgtgatgccccttatttc
ggtttcgaagtaccggatgcaccgggtaaatatttttacgtctggttagatgccccaatc
ggttacatgggggcgtttaaaaacctatgtgataaacgtggtgacctggattttgatgaa
ttctggggtaaagacgccaaaactgacctctatcacttcatcggtaaagatattgtttac
ttccacagtctgttctggccagccatgttggaaggcagtaacttccgcaagccgacaaac
ctgtttgtccatggctatgtcacggtaaacggcgcgaaaatgtctaaatctcgcggtacg
tttattaaggcggggacttacctgaaatatctggatgcggattgcctgcgttactactac
gcggcgaaactctcttcgcgtattgatgatatcgatttaaatctggaagatttcgtccaa
cgcgttaacgccgatatcgttaataaagtggtgaatctggcctcacgtaatgctggtttt
atcaataaacgctttgcaggccagttagctgaccaattggctgacccggtgttgtataaa
acattcaccgatgccgcaaccagtattgctgatgcttataacaaccgtgagtcaggtaaa
gccattcgtgaaattatggcgctagctgatgtggctaatcgctatgttgatgaacaggct
ccatgggtggtcgctaaacaagaaggccgcgatgccgatctacacgctatctgctcgatg
gggatcaacctattccgtgtcctgatgacctatctgaaaccggtattaccctctctgaca
gagcgtaccgaggccttcctcaataccgagctaacttgggatagcattgaacaacctctg
ctgggccactctatcaccgctttcaaggcactgtttaatcgtattgatttagacaaagta
aacgaaatggtcgcctcgtctaaagaagatatggcacctgcaaccagggttacaggcccg
ttagccgatgatccaattcaggaaaccatcagttttgatgactttgccaaagttgatatg
cgaattgcgttgattcaacaagccgaatttgttgaaggctcagataagttattaaaacta
acacttgaacttggaggggagacccgccaggtattctcgggtatccgttcagcttaccct
gacccaaaagccttggaaggccgcatgaccgtgatggtcgctaaccttgccccgagaaaa
atgcgctttggggtttcagaaggcatggtgatggccgcaggccccggaggtagcgatatc
ttcctgcttagccctgacagtggtgcgcagccaggcatgcaagtgaagtga

DBGET integrated database retrieval system