KEGG   Yersinia pestis D182038: YPD8_2144Help
Entry
YPD8_2144         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K09899  uncharacterized protein
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    YPD8_2144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF412
Motif
Other DBs
NCBI-ProteinID: ACY62821
Position
2730261..2730716
Genome map
AA seq 151 aa AA seqDB search
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT
WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV
APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaaccctctgattcggtaagctggtttcaggtactccagcgcggtcagcat
tatatgaagacctggccagcggacaagcgcttggctccggtgttccccgagaatcgtgtc
acggtagtgacccgttttggtatccgttttatgcccccattggccatttttaccctgacc
tggcagatagcgctgggggggcaacttgggccagcgatcgccacggcgctctttgcctgc
ggtttaccgctgcaaggattatggtggttaggtaaacgggcgatcacgccgttaccccct
acgttattgcagtggtttcatgaagtgcgtcataaactgttcgaagcagggcaagcggtc
gcccccatcgaaccgatcccaacttatcagtctttggctgatctgctaaaacgtgccttt
aaacagttagacaaaacgtttctcgatgatttgtaa

DBGET integrated database retrieval system