KEGG   Yersinia pestis D182038: YPD8_2149Help
Entry
YPD8_2149         CDS       T01833                                 

Gene name
aat
Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00220  Arginine biosynthesis
ypx00250  Alanine, aspartate and glutamate metabolism
ypx00290  Valine, leucine and isoleucine biosynthesis
ypx01100  Metabolic pathways
ypx01110  Biosynthesis of secondary metabolites
ypx01130  Biosynthesis of antibiotics
ypx01210  2-Oxocarboxylic acid metabolism
ypx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPD8_2149 (aat)
   00290 Valine, leucine and isoleucine biosynthesis
    YPD8_2149 (aat)
   00220 Arginine biosynthesis
    YPD8_2149 (aat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypx01007]
    YPD8_2149 (aat)
Enzymes [BR:ypx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YPD8_2149 (aat)
    2.6.1.66  valine---pyruvate transaminase
     YPD8_2149 (aat)
Amino acid related enzymes [BR:ypx01007]
 Aminotransferase (transaminase)
  Class I
   YPD8_2149 (aat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACY62826
Position
complement(2735555..2736769)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLFSARKAIMQHYQARNIRDLTVEDIYIGNGVSELIVQSMQALLNLGD
EMLVPAPDYPLWTAAVSLSSGKAIHYMCDEESGWFPDLDDIRSKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQNDLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRDRAWELINQIPGVSCVKPQGALYMFPRIDQKRFNLKDDQKLVLDLLLQEK
VLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRKLGRFLETYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgagaaatccagcaaactggacaacgtctgttatgacattcgtggaccg
gtgctaaaagaagctaagcgtcttgaagaggaaggtaacaaggttctgaaactgaacatc
ggcaaccctgccccgtttggtttcgatgcacccgacgagattctggtggatgtaatccgt
aatttaccgaccgcacaaggctattgcgactccaaaggcttgttttcggcacgtaaagcc
attatgcaacactatcaagcccgcaatatccgtgatctgacggtcgaggatatctacatt
ggaaacggtgtttccgagttgatcgttcaatccatgcaagcattactgaatttgggtgat
gaaatgctagtacccgcaccggattacccgctgtggacagctgccgtgtcgctctcaagt
ggtaaagcgattcattatatgtgtgatgaagagtcaggctggttccctgatttggatgat
attcgcagcaaaatcactccgcgtacccgtgggattgtgattatcaacccgaataaccca
accggtgcggtatacagcaaagagctgctgttagaaattgttgaaattgctcgccagaat
gacctaattattttcgctgatgagatctacgataaaattttgtatgacgatgctcagcac
cattcgatcgccgcattagcccctgatttgctgaccgttacgttcaatgggctgtctaaa
acataccgtgttgcgggtttccgccagggctggatggtgttgaacgggccgaaaaagcac
gctaaagggtatattgaaggcttggaaatgctggcatcgatgcgtttgtgcgccaacgta
ccaatgcagcatgcgattcaaaccgccttgggcggctatcagagcattagtgagtttatc
caacctggtggccgtttgtacgagcagcgtgatcgggcctgggagcttatcaaccaaatc
cccggtgtttcctgtgtgaaacctcagggcgcgttgtatatgttcccacgtattgatcag
aaacgttttaacctgaaagacgaccagaagttggtattggatctgttgttgcaagagaaa
gtgctattggtgcaaggtagcgcctttaactggccgtacccggaccatgtgcggatcgtc
acgctgccacgggtggatgagctagagatggcggtgaggaagctggggcggttcttagag
acgtatcatcagtaa

DBGET integrated database retrieval system