KEGG   Yersinia pestis D182038: YPD8_2161Help
Entry
YPD8_2161         CDS       T01833                                 

Gene name
nuoL
Definition
(GenBank) NADH dehydrogenase subunit L
  KO
K00341  NADH-quinone oxidoreductase subunit L [EC:1.6.5.3]
Organism
ypx  Yersinia pestis D182038
Pathway
ypx00190  Oxidative phosphorylation
ypx01100  Metabolic pathways
Module
ypx_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YPD8_2161 (nuoL)
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     YPD8_2161 (nuoL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M Proton_antipo_N
Motif
Other DBs
NCBI-ProteinID: ACY62838
Position
2749617..2751461
Genome map
AA seq 614 aa AA seqDB search
MNLLYLTILLPLLGFLLLAFSRGRWSENTAATVGVGSIGLTALVTLYVAVDFLSQKATGV
QVFNQTLWNWMSVGTFNIPLTLTLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFF
AYTNLFIASMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYKHSANGAAAMKAFIVTRVG
DVFLAFALFILYQELGTLNIRELMILAPQKLEMGSTAITWATLMLLGGAVGKSAQLPLQT
WLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMAPEVLHLVGVIGAVTLVLAGFA
ALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLSSGSVILACH
HEQNIFKMGGLRKTIPLVYICFLVGGAALAALPIVTAGFYSKDEILWGALASGHINLMVA
GLVGAFLTALYTFRMIFIVFHGEPKTKAHPVKGITHSLPLIVLLVLSTFVGALITPPLAG
VLPELHFGDEGKMPLEIFSGVLVVIGIALAAFLYLGKRQLVNSIAQSAPGRFFTVWWFHA
WGFDWLYHNLFVRPYLWIAKLLQRDPLNSLMNTPAVLSRWSNRGLTVSENGQVRWYAASI
GLGAVIVLALLLFV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaacctattatatttaacaattctgctgccactgctgggcttcttgctgttggcattc
tcccgtgggcgctggtctgaaaataccgcggctaccgttggggtggggtctatcgggctg
actgcgctggtgacgttgtatgtggcggtggatttcctcagccaaaaagccactggcgta
caggtgtttaatcagacgctgtggaactggatgtctgttggcacctttaacattccgctg
accctgacattggacggtttgtcgctgaccatgttgtcggtggtgaccggtgtcggcttc
ctgatccacatgtatgcctcgtggtatatgcgtggggaagagggctactctcgcttcttc
gcctataccaacctgtttatcgcgagcatggtggttctggttctggcggataacctgttg
ctgatgtatctcggctgggaaggcgtggggctgtgcagttatctgctgatcggtttctac
tacaagcattctgccaacggtgcggcggcgatgaaagcctttatcgtgacccgtgtgggt
gacgtattcctggcttttgcgctgttcattctttaccaagagttgggcacgctgaacatc
cgcgaactgatgattttggcaccgcagaaactggagatgggctcgaccgccattacctgg
gcgacgctaatgctcttggggggggcggtcggtaaatcagctcagttgccgctacaaacc
tggttggctgatgcgatggccggcccgacgccggtttccgcgctgatccatgcggcgacc
atggtgaccgccggtgtctatctgattgcccgtactcatggcctgttcctgatggcccct
gaagtactgcatttagtcggggttatcggtgcggtcacactggtgttggcgggctttgcc
gcactggtgcaaaccgacatcaagcgggtgttggcgtactccaccatgagccagattggc
tacatgtttctggcgctgggcgtacaggcgtgggatgcggcaatcttccatttgatgacc
catgccttctttaaagcgttactgttcctttcctcaggctcagttattctggcctgccac
cacgagcaaaatatcttcaaaatgggcggtctgcgtaagaccattccattggtctatatc
tgcttcctggtgggtggtgcagcattggcagccttgccaatcgtcactgccggcttctat
agcaaagacgaaattctgtggggcgcattggccagtggccatatcaatctgatggtagca
gggttggtcggggcattcctcaccgcgctgtatactttccggatgattttcattgtgttc
catggtgagccaaaaactaaagcacatccggttaaagggatcacccatagcctgccgtta
atcgtgttactggtgctgtcgacctttgtcggtgcgttgataacaccaccactggcgggt
gtgttgcccgagcttcactttggtgacgagggcaaaatgccgttggaaattttctccggt
gtcttggtggtgatcggtattgcactggccgcgttcttgtatctgggcaaacgccaattg
gttaacagcattgcgcaaagtgcgccgggccgcttctttacggtctggtggttccatgcg
tggggcttcgactggttgtaccataacctgtttgtccgcccgtatctgtggattgcaaaa
ctgttgcaacgtgatccgctgaattcactgatgaatacaccggcggtgctttcgcgctgg
agtaatcgcggtctgaccgtcagtgagaatgggcaggtgcgttggtacgccgcctctata
ggtttgggtgcagtgattgtgctggctctgttgcttttcgtgtag

DBGET integrated database retrieval system