KEGG   Yersinia pestis D182038: YPD8_2164Help
Entry
YPD8_2164         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACY62841
Position
2754739..2755929
Genome map
AA seq 396 aa AA seqDB search
MWVLPINSNPTVLHPPMVDRVYIDRQIDELELYFCPDTGKCKKLTTEMRVRNEIYKNLDY
FYYFLEKSYTSVALSLLIVEQAWTNTHQPVSRGNIKPEYRLDDYRRESLCEFAIREILKT
VDEAIISQPSTTDSFTKKKNKKAYEDIISMVSYLVGLTKDKIQGAKQRYGSDPITQVLFQ
EFNKRNIFHDYSGNEQDVLKDAMNGIVYSCYKFYSEKEKLPSVDVIKKIMKEVPQSINYP
DSETAAYRLISKAIIDPMIIDINYEKHCHLSHLNALARTLIAKDIPITHNRKYKHYLTDN
LNNKFIRLFLLDKTFDIRKSELYQRVEQHLREINENISADDILRCCKDYYEFAREKYALK
IPSLAEVEFTEQLTRSGHISAAIEHRRHGTYLPRTV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtgggttttacctataaattctaatccgactgttttacatccaccaatggtggataga
gtttatatcgatcgacagatcgatgaattggaactttatttttgtcctgataccggaaaa
tgtaaaaaattgactactgaaatgagagtccgcaatgaaatatataaaaatctggattat
ttttattactttttggaaaaatcatacactagtgtcgcgctgagtttgctgattgtagaa
caggcgtggacaaatacacatcaacccgtttcacgtggaaacatcaaaccagaatatagg
cttgatgactaccgtagagaatcgctttgtgaatttgctatcagagagatactgaaaaca
gtagatgaagcaataatatcgcaacccagtacaaccgatagttttactaaaaaaaagaac
aaaaaggcatatgaagatattatctcaatggtttcgtatttagtagggttgactaaagat
aaaatacagggagcaaagcaacgctatggttcagaccctataacgcaagttttatttcag
gaatttaacaaaagaaatatatttcatgactatagcggcaatgaacaagatgtattaaaa
gatgctatgaatgggatcgtttattcatgttataaattctatagtgagaaagaaaaatta
cctagtgtagacgtaataaaaaaaatcatgaaagaggtgccgcagagtattaattatccg
gattctgagactgccgcctatcgccttatctctaaagctattattgaccctatgattata
gatattaattatgaaaaacattgtcatctttctcatttaaatgcgttggccagaactcta
attgcaaaagatattcctattacccataaccgaaaatataaacattatcttactgataat
ttaaataataaattcatccgcttattcttattggataagaccttcgatatccgcaagagt
gaactttatcagcgagtcgagcaacatttacgggagatcaatgaaaacatctctgcggat
gatattctccggtgctgcaaagattattatgaatttgcccgtgaaaagtatgcgctgaaa
ataccttctttggctgaagttgagtttacggaacaactcacgcgcagcggccatatctca
gcagcaatagaacatcggcgtcatggtacgtatctgccccgaacagtatga

DBGET integrated database retrieval system