KEGG   Yersinia pestis D182038: YPD8_2168Help
Entry
YPD8_2168         CDS       T01833                                 

Definition
(GenBank) putative lipoprotein
Organism
ypx  Yersinia pestis D182038
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHL10 Melibiase GHL6
Motif
Other DBs
NCBI-ProteinID: ACY62845
Position
complement(2758920..2760203)
Genome map
AA seq 427 aa AA seqDB search
MLLHLKGSHRFISLMLCALLLAGCGHQRMPEKPVSPVGKEEPVRGVWLTTVLRLDWPSLS
SINASSDSIRISTQKKELTDTLDDLVKNGVNTLFFQVKPDGSALYHSAILPWSDVLTGVT
GKDPGYDPLAFAVSEAHKRGLKIHAWLNPYRVSMDTRPETSASLERTLSSSPASVYALHK
DWIRTANGRFVLDPGLPEVRHWITNIVAELVKNYDIDGIQFDDYFYYETPSSRLDDDATY
QKYGQSFSDKANWRRNNTLLLIKQVSSTVRSLKPEIEFGVSPAGVWRNQADDPLGSETQA
GSPSYDTAYADTRLWVQDGLLDYIAPQLYWTHSQKKVKYDTLATWWADTVRHSHTKLYIG
VALYKVGQPSQAESDWALEGGVPELKRQLDLNDALPEISGTILFREAFLRQPQTEEAVKY
LKSRWRN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacatctgaaaggaagccaccgattcattagcctgatgctctgcgcattatta
ctcgctggctgtggacatcagcggatgccagagaaacccgtgagtccggtagggaaagaa
gagccggttcgtggtgtctggctaaccaccgtgctcagacttgactggccttcactttca
tcgattaacgctagctcagactcgatcaggatcagcacgcaaaagaaagaactgacagac
acattagatgacttggtgaaaaacggcgtcaacacccttttctttcaagtaaagcctgat
gggagcgcgctttatcattcagccattcttccctggtcggatgttttgaccggtgtaacg
ggtaaagatcccggttatgaccctctggcctttgcggtatctgaagcacataaacgaggg
cttaagatacacgcgtggctgaacccctaccgtgtctcaatggatacccggccggaaacg
agtgcatcacttgagcgcacgctctcttcttcgccagccagtgtctacgcgctgcataaa
gattggatacgcaccgccaatggccggtttgttctcgatccggggttacccgaggtacgc
cactggatcaccaatattgttgccgaactggtcaaaaattatgacatcgatggcatacag
tttgatgattatttctattatgaaaccccgtcatcccggcttgatgatgatgccacatac
cagaaatatgggcagtccttcagcgataaggccaattggcgcaggaacaatacgttgttg
ctcataaaacaggtctcttcaaccgtcaggtcccttaaaccagagattgagtttggtgtc
agcccggcgggcgtctggagaaatcaggccgatgatcccctagggtcagagacacaggca
ggcagcccttcttacgataccgcatatgccgatacccgtttatgggtgcaggacggttta
ctggattatatcgcaccacaactctactggacgcatagccaaaaaaaggtcaaatatgac
acgctggcaacatggtgggcagataccgtcaggcatagccacaccaaattgtatatcggc
gtcgcgttatacaaggttggccaaccctcgcaggccgaatctgactgggcactggaaggc
ggtgtgcctgagctaaagcggcaactggatctcaatgacgcgctgccggaaatcagcgga
acgattctgttcagggaagcgtttctccgtcagccccagacggaagaggcggtaaaatat
ttgaagtccaggtggcgtaactga

DBGET integrated database retrieval system