KEGG   Yersinia pestis D182038: YPD8_2183Help
Entry
YPD8_2183         CDS       T01833                                 

Definition
(GenBank) hypothetical protein
  KO
K06970  23S rRNA (adenine1618-N6)-methyltransferase [EC:2.1.1.181]
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ypx03009]
    YPD8_2183
Enzymes [BR:ypx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.181  23S rRNA (adenine1618-N6)-methyltransferase
     YPD8_2183
Ribosome biogenesis [BR:ypx03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    YPD8_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_10 MTS Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACY62860
Position
2779644..2780654
Genome map
AA seq 336 aa AA seqDB search
MLSYAPENAYQRASTMENKKVFPKEKSGLHPRNRHCSRYDFDALSVSCPELIPFLAPTAY
GDISVDFADPLAVKMLNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLASCNG
EVIPKGKNIALLDIGVGANCIYPIIGQREYGWRFTGTDIDSHALSAAKMVVSMNPTLKNT
LRLKQQKDPHAIFEGVWAVNERYDATLCNPPFHGSAEEAAATTRRKLHKLGKNEVAAKPV
QNFGGKNSELWCEGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAV
EVRTIEMAQGQKVSRFVAWTFLTPEQQAAWVAERWA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctatcttacgcgccagaaaatgcctatcagagagccagtacgatggaaaataaaaaa
gtattccccaaagaaaaaagcggattgcatccccgaaatcgtcattgctcacgctatgat
tttgatgcgctttcagtgagttgccctgagctaatcccttttctggccccgaccgcctat
ggtgatatttctgtcgattttgctgatccattagcagtaaaaatgttgaataaggcatta
ttaaaacatttctatggcattgaatattgggacattccagccgattctttatgtcctccc
attcctgggcgtgccgattacgtgcaccatctggccgatctattagccagttgcaatggc
gaggtgatccctaagggcaagaatattgcgttgctggatattggcgtcggcgctaactgt
atttacccaattattggtcagcgggagtacggctggcgttttaccggtacggatattgac
tcacacgcgctcagtgcggcaaaaatggtggtgtcgatgaacccgaccctgaaaaatacc
ttgcgcctgaagcagcaaaaagatccacacgctatttttgaaggggtgtgggcggtgaat
gagcgttacgatgcgacgctgtgtaacccgccattccatggttcagcagaagaagcggcg
gccaccactcgccgtaaattgcacaaactggggaaaaatgaagtcgctgcaaagccagta
cagaacttcggtggtaaaaacagtgagttatggtgtgaaggtggggaggaagggtttgtc
agccgcatggtggcagagagcgtagcgaaagcgcagaactgtttctggtttacctcattg
atttccaagaagaccacgttaccggcgatttatcatgctctaagatatgtgaaggcagtt
gaggtgcgcactattgagatggcgcaagggcaaaaagtcagtcggtttgtggcctggacg
ttcctgacgcccgagcagcaagccgcgtgggttgcagagcgctgggcataa

DBGET integrated database retrieval system