KEGG   Yersinia pestis D182038: YPD8_2195Help
Entry
YPD8_2195         CDS       T01833                                 

Gene name
ompX
Definition
(GenBank) outer membrane protein X
  KO
K11934  outer membrane protein X
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypx02000]
    YPD8_2195 (ompX)
Transporters [BR:ypx02000]
 Other Transporters
  Pores ion channels [TC:1]
   YPD8_2195 (ompX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ail_Lom OMP_b-brl
Motif
Other DBs
NCBI-ProteinID: ACY62872
Position
2792448..2792972
Genome map
AA seq 174 aa AA seqDB search
MKKIACLSAVAACVLAVTAGSAFAGQSTVSGGYAQSDYQGVANKSSGFNLKYRYEWSDSQ
LGYITSFTHTEKSGFGDEAVYNKAQYNAITGGPAYRINDWASIYGLVGVGHGRFTQNESA
FVGDKHSTSDYGFTYGAGLQFNPAENVALDVSYEQSRIRNVDVGTWVAGVGYTF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcatgtctttcagcggtagcagcgtgtgtgttagccgtgaccgcaggt
tctgcctttgcaggtcaaagcaccgtttctggtggttatgcccagagcgattatcaaggt
gttgcgaacaagtcttcaggttttaacctgaaataccgttatgagtggagtgactctcaa
ctgggttacatcacctctttcactcacactgaaaaaagcggtttcggtgacgaagcggtt
tacaacaaagcgcaatataatgcgattaccggtggtccagcataccgcatcaatgattgg
gctagcatttatggtctggtcggtgtgggtcatggtcgtttcacccaaaacgagtcagca
ttcgttggtgataaacacagcaccagtgactacggcttcacctacggtgctggcttgcag
ttcaacccagccgaaaacgttgctctggatgtttcttacgagcagagccgtatccgtaac
gttgacgtaggtacttgggttgctggcgtaggttacactttctaa

DBGET integrated database retrieval system