KEGG   Yersinia pestis D182038: YPD8_2208Help
Entry
YPD8_2208         CDS       T01833                                 

Definition
(GenBank) putative dioxygenase alpha subunit
  KO
K22443  carnitine monooxygenase subunit [EC:1.14.13.239]
Organism
ypx  Yersinia pestis D182038
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YPD8_2208
Enzymes [BR:ypx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.239  carnitine monooxygenase
     YPD8_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_A Rieske Rieske_2
Motif
Other DBs
NCBI-ProteinID: ACY62885
Position
2807184..2808308
Genome map
AA seq 374 aa AA seqDB search
MSNQHPDFVLPKDFCANPREAYTIPAYFYTQQAAFEHEKERVFTNSWICMAHGSEVAQPN
DYITREIIGENIVIVRGRDSVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWTFKLDG
ELAHARNCENVTNFDKDRATLFPVRLEEYAGFIFINMNPDAESVEQQLPGLQDKVFEACP
DVHELKLAARFTTRTPANWKNIVDNYMECYHCEPAHPGFADSVQIDRYWHTMHGNWSLQF
GYAKPSEKSFKFEEGEESSFHGFWLWPCSMFNVPPLKGMMTVIYEFPVDAETTLQNYDIY
FTNEELTEDQKALIEWYRNVFRPEDLRLVESVQKGLKSRGYRGQGRIMADDKGSGISEHG
IAHFHNLVAKVFQE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaacatcctgactttgttttgccaaaagacttttgtgcaaacccgcgtgag
gcttacaccattcctgcttatttctatacccaacaggcggccttcgagcatgagaaagag
agggtatttactaatagctggatttgtatggcgcacggcagtgaagtggcgcagcctaat
gattacatcactcgtgagattattggtgagaacatcgttatcgtgcgtggacgtgatagc
gtattgcgggctttttataatgtctgtccgcatcgtgggcaccaattactcagtggggaa
ggtaaagcaaagaatgtcattacttgcccctatcatgcctggaccttcaagctcgacggt
gaactggcacatgcccgtaactgcgagaatgtcactaattttgataaagatcgggcgacg
cttttcccggtgcgcttagaggaatatgccggttttattttcatcaatatgaacccagac
gccgaaagcgtggaacaacaattgccgggcttacaggataaagttttcgaagcgtgcccc
gatgtgcacgagttgaaattggccgctcgcttcaccacccgtacccctgctaactggaag
aatattgtcgataactatatggagtgttatcactgcgagcctgctcacccaggattcgcc
gattcagtgcagattgatcgctactggcacaccatgcacggtaattggtcattacaattt
ggctatgcgaaaccctcagaaaagtcctttaaatttgaagagggtgaagagtcctctttc
cacggcttttggctatggccatgctcaatgttcaatgtgccgccactgaaaggcatgatg
accgtaatttatgagttcccagtcgatgcagaaacgacgctgcaaaactatgatatttat
tttacgaacgaagaactgacggaagaccagaaggcgcttatcgaatggtatcgcaatgtc
tttcgcccggaagatttacgcttggttgaaagcgttcagaaagggctgaaatcacgcggc
tatcgtggtcaagggcgtatcatggctgatgataaaggcagtgggatcagtgagcatggt
attgctcacttccataatctggtggcgaaggtctttcaagagtag

DBGET integrated database retrieval system