KEGG   Yersinia pestis D182038: YPD8_2222Help
Entry
YPD8_2222         CDS       T01833                                 

Definition
(GenBank) sugar ABC transporter, permease protein
  KO
K02026  multiple sugar transport system permease protein
Organism
ypx  Yersinia pestis D182038
Module
ypx_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:ypx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypx02000]
    YPD8_2222
Transporters [BR:ypx02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    YPD8_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACY62897
Position
2832063..2832887
Genome map
AA seq 274 aa AA seqDB search
MKKNINSLIIHLVMFSLALSWLYPYIWMVLSSFKQSADIYTTGLFGSAYSLDNYRFLFEN
SGRVEKPFLKTLFNSLFISTVVTVAVTLSSMFIGFALAKMQFKGQSLFRNLLFLQMVFPA
SMFIIPQFVLVRELGLLNTYSAMIVPFLMSSWGIFMISQSFQGTPNDYIHAAKIDNASLW
QIMIYLMMPLNKAIIAIVALFTFVGTWDNFLWPLIVIQDESKMPLSVLLATFSKSYGVYV
GPVIAGAVIQTIPIVVLFILFRKYFMQGMSLSLK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaacatcaacagtttaattatccatctggttatgttttctctggcgctttcg
tggctctatccctatatctggatggtgctttcttcctttaaacagtctgccgatatttat
actaccgggctgtttggtagcgcttactcactcgataattaccgttttttgtttgaaaac
agtggccgggtggaaaaaccttttttaaagacgctatttaactcactctttatttcaaca
gtagtgacggtagccgttacccttagctccatgtttattggatttgcgctggcaaaaatg
caatttaaaggccagtccctgtttaggaatttactgtttttacaaatggttttccctgcg
tcgatgtttatcatcccgcaattcgttttagtcagagaactggggttattaaacacctat
agcgccatgattgttccttttctcatgagttcttgggggatctttatgatttcacagagc
ttccaggggacgccgaatgattatattcatgcggccaaaattgataatgctagtctgtgg
caaattatgatttacctgatgatgccgctgaataaagcaattatcgccattgtggcattg
tttacctttgtcggcacatgggacaacttcttatggccactgattgttatccaggatgaa
agcaaaatgccgctctcggtattactggccacattcagcaaatcttatggcgtttatgtt
gggccagtgatcgctggtgcggtcattcagaccatcccgatcgtcgtactgtttatttta
ttccgtaaatatttcatgcagggcatgtccctatcattaaagtag

DBGET integrated database retrieval system